KEGG   Delftia sp. HK171: BO996_05755Help
Entry
BO996_05755       CDS       T04584                                 

Definition
(GenBank) hypothetical protein
Organism
dhk  Delftia sp. HK171
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3108
Motif
Other DBs
NCBI-ProteinID: APE51499
LinkDB All DBs
Position
complement(1277857..1279017)
Genome map
AA seq 386 aa AA seqDB search
MTDMSLRQRALPALTAVVLGVHALALLGLPLWSQVSAPRTEVAAMQTRALSLPEPPAPPP
AAPVPAPKAPAPKPQQPRPKVQRPAPAASVAEPLDTPIRETVEPLPMAAAPEPAASDASE
TAAADSGAPPATPPAPPAPKPEPETPPTPSAGPAQGMAITSPDGTPLASDAPVPVQLPDP
ARLSFAVTGQAKRFNYSASAELVWRHANGQYQASQEVSLFLLGSRSQTSAGRITDRGLEP
SRFNDKARKEQSAQLAFDQNLAHFSTGAPDAAIAPGAQDRLSVFLQLSALLAAAPQRYPA
GTQISFITVSARRADRWTFRVGETETLDLPSGSTQALRLDKIAAAGDDQQASLWLAPSMQ
YLPVRIRLAQDNGDFADLQLKGRQAP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ataactgacatgagcctacgccagcgcgccctgcccgccctcaccgccgtggtgctgggc
gtgcacgccctggccctgctgggcctgccgctgtggagccaggtgtcagcgccgcgcacc
gaggtggcggccatgcagacgcgggcgctgtccctgcccgagccacccgcccccccgcct
gcagcgcccgtacccgcaccgaaggcgcctgcgcccaagccgcagcagcctcgccccaag
gtccagcgcccggcacccgccgcatccgtggccgagccgttggacacgcccatccgcgaa
accgtggagcccttgccgatggccgcagcgccggagcctgccgcatcggacgcatcggaa
accgctgctgccgacagcggggcacccccggccacgccgccggcgccgcccgctcccaag
cccgaacccgaaacaccacccacaccctcggccggcccggcccagggcatggccatcacc
tcgcccgatggcacgccgctggcctccgacgcccccgttcccgtgcaactgcccgatccc
gcgcggctgtcgttcgccgtcaccggccaggccaagcgcttcaactactcggccagtgcc
gagctggtctggcgccatgccaacggccagtaccaggccagccaggaagtcagcctgttc
ctgctgggctcgcgctcgcagaccagcgcgggccgcatcaccgacaggggcctggagccc
agccgcttcaacgacaaggcacgcaaggagcaatcggcgcaactggcgttcgaccagaac
ctggcgcacttcagcacgggcgcgcccgatgccgccatcgcgcccggcgcgcaggaccgg
ctcagcgtgttcctgcaactgtcggccctgctggcggcggcgccgcagcgctaccctgcg
ggcacgcagatcagcttcatcaccgtcagcgcacggcgcgccgaccgctggaccttccgc
gtgggcgagaccgagacgctggacctgccctcgggcagcacgcaggcgctgcggctggac
aagatcgcggcggccggcgatgaccagcaggcctcgctgtggctggcgccgtccatgcaa
tacctgcccgtgcgcatccggctggcgcaggacaacggcgacttcgccgacctgcagctc
aagggccgccaggcaccctga

DBGET integrated database retrieval system