KEGG   Delftia sp. HK171: BO996_06545
Entry
BO996_06545       CDS       T04584                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K21061  D-hydroxyproline dehydrogenase subunit beta [EC:1.5.99.-]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00330  Arginine and proline metabolism
dhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BO996_06545
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     BO996_06545
SSDB
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 Pyr_redox_3 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox Thi4 GIDA 3HCDH_N AlaDh_PNT_C UDPG_MGDP_dh_N FAD_binding_3
Other DBs
NCBI-ProteinID: APE47534
LinkDB
Position
1457403..1458518
AA seq 371 aa
MKNYDLIVVGAGIVGLAHAYAAARRGRSVLVIERDAACISASIRNFGFVTVTGQQAGAHW
RRAMRSRDTWAEIAPQAGIEVVHRGLWLTARRPSAEAVLHAFLSTSMGERCELLTPAQAA
ERHPALRTGDLSAVLYSPHELRVESRTAIPRLAQWLEQAMGVDFRFGEAVLDVAAPRVRS
TRASYHGERVVVCNNADPGGLFAGLWAPHRIQLCQLQMLRVRPQPGFRLKGSVMGDLSMV
RYEGYSALPEAAALRAELEREEGESLAHGIHLIAVQSADGSLVVGDSHHYGAAPQPFASE
AVDRLMLRHMNEALNLRDAQVVERWVGVYPSAQDAPCVVHAPDEATRVVAVTGGSGASTA
FGLAEEVWSAW
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaagaactacgacctgatcgtggtgggggccggcattgtcggcctggcccacgcctat
gcggctgcgcgccgtggccgcagcgtgcttgtcatcgagcgcgacgcggcctgcatctcc
gcctccatccgcaacttcggctttgtgaccgtcacggggcagcaggccggggcccactgg
cggcgtgccatgcgctcgcgcgacacctgggccgagatcgcgccgcaggccggcatcgag
gtcgtgcaccgcggcctgtggctgacggcgcgccgccccagcgctgaggccgtgctccat
gccttcctgagcacctccatgggcgagcgctgcgagctgctcacgccggcccaggccgcc
gaacgccatcctgcactgcgtaccggggatttgtccgccgtgctctacagcccgcatgaa
ctgcgcgtggagtcgcgcacagccattcccaggttggcgcagtggctggagcaggccatg
ggagtggatttccgctttggcgaggccgtgctcgacgtggccgcgccccgggtgcgcagc
acgcgcgccagctaccacggcgagcgcgtggtggtctgcaacaacgccgacccgggcggc
ctgttcgccggcctgtgggcgccgcaccgcatccagctgtgccagctgcagatgctgcgc
gtgcggccgcagccgggctttcggctcaagggctcggtcatgggtgacctgagcatggtc
agatacgagggctacagcgccctgcccgaagccgccgcgctgcgcgccgagctggagcgg
gaggagggcgaaagcctggcccacggcatccacctgatcgccgtgcaaagcgctgatggc
agcctggtggtgggcgattcccaccactacggcgcagcgccccaaccctttgccagcgaa
gccgtggaccggctgatgctgcgccacatgaacgaggccctgaacctgcgcgatgcgcag
gtggtggagcgctgggtgggcgtctacccgagtgcgcaggacgcgccctgcgtggtgcat
gcgcccgacgaggccacgcgcgtggtggcggtcaccggaggttccggcgcgagcactgcc
ttcgggcttgccgaagaggtctggagcgcgtggtga

DBGET integrated database retrieval system