KEGG   Delftia sp. HK171: BO996_10970
Entry
BO996_10970       CDS       T04584                                 

Definition
(GenBank) ferredoxin reductase
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00071  Fatty acid degradation
dhk00360  Phenylalanine metabolism
dhk01100  Metabolic pathways
dhk01120  Microbial metabolism in diverse environments
dhk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BO996_10970
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BO996_10970
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     BO996_10970
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox Pyr_redox_3 NAD_binding_8 DAO AlaDh_PNT_C GIDA XdhC_C FAD_binding_2 Amino_oxidase FAD_binding_3 2-Hacid_dh_C HI0933_like Trp_halogenase UDPG_MGDP_dh_N NAD_binding_7 3HCDH_N
Other DBs
NCBI-ProteinID: APE48341
LinkDB
Position
complement(2439412..2440647)
AA seq 411 aa
MTPAQHAQGHAVIIGAGHAGGTLAALLRQYGHPGPITLVGGEDLPPYQRPPLSKAWLQQP
MGPDDLLLRPASAYADQAIALRLGVRAMAIEPGSRQVALNDGSALHYDQLVIATGAAPRW
LALPGGERPGVTYLRTMEDAQALRGHLQTARCLAIIGGGYVGLEVASTARKLGVQVRVIE
REGRLLSRSASPQMAANLHGLHAGQGVEVHFNASVTAIQGDSPTGITGLRMADGSRLECD
AVLIGVGAAPSVELAQSLGLDCAGGIAVDGEGRTAMAGIYAIGDATRRPLAGYPGLHRLE
SVPSALEQARRAACSITGRALPAHEAPWFWSDQYDTKLQIAGLPGHGDQTVLRGDPASGR
FAVLHLRGGQLCAAECVNSPGEFMAARKAIAATHCADPGFPPLPPKAPPTP
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgacccccgcacaacacgcccaaggccacgccgtcatcatcggcgccgggcatgccggc
ggcaccctggccgccctgctgcgccagtacggccacccgggccccatcaccctggtcggc
ggcgaagacctgccgccctaccagcgcccgccgctgtccaaggcctggctgcagcagccc
atgggcccggacgatctgctgctgcggcccgccagcgcctatgccgaccaggccattgcc
ctgcgcctgggcgtgcgcgccatggccatagagccgggctcgcggcaggtagcgctgaac
gacgggtcggcactgcactacgaccaactggtcattgccacaggcgccgcaccgcgctgg
ctggccctgcccgggggtgagcggcccggcgtgacctacctgcgcaccatggaagacgcg
caggcgctgcggggccacctgcagaccgcccgttgcctggccatcatcggcggcggctat
gtgggtctcgaagtcgcgtccacggcccgcaagctgggggtgcaggtccgggtcatcgag
cgcgaaggcaggctgctgtcgcgcagcgcctcgccccagatggccgcaaatctgcacggc
ctgcatgcaggccagggcgtggaggtgcatttcaacgcttcggtcaccgccatccagggc
gacagccccaccggcatcacgggcctgaggatggccgatggctcccgcctggagtgcgat
gccgtgctcatcggcgtgggcgcagcgcccagcgtggagctggcacagtccctcggcctg
gactgcgcgggcggcattgccgtggacggcgaaggccgtaccgccatggccggcatctac
gccataggcgatgccacgcgccgccccctggccggctaccccgggctgcaccggctcgaa
agcgtgcccagcgcgctcgaacaggcccggcgcgcagcctgctccatcacgggccgcgca
ctgcccgcccatgaagcgccctggttctggtcagatcagtacgacaccaagctgcagatc
gccggcctgcccggccatggcgaccagaccgtgctgcgcggcgacccggccagcggcagg
ttcgccgtcctgcacctgcgcggtggccagctgtgcgccgccgaatgcgtgaactcaccg
ggcgaattcatggcagcgcgcaaggccatcgccgccacgcactgcgccgaccccggtttc
ccgcccctccccccaaaagccccacccacgccatga

DBGET integrated database retrieval system