KEGG   Delftia sp. HK171: BO996_11000
Entry
BO996_11000       CDS       T04584                                 

Definition
(GenBank) glutathione-disulfide reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00480  Glutathione metabolism
dhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BO996_11000
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     BO996_11000
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_2 HI0933_like DAO NAD_binding_8 K_oxygenase
Other DBs
NCBI-ProteinID: APE48347
LinkDB
Position
complement(2446407..2447756)
AA seq 449 aa
MKHYDYIVIGGGSGGIASANRAAMHGRHCALIEAGEIGGTCVNVGCVPKKVMWHAAQIGE
AMHRYGPDYGWDATVNRLDWQRLLDSRSAYIDRIHASYESGLARNKVELIQGFGRFVDAR
TVEVGGQRLSADHILIATGTRPARPDIPGAELGIDSDGFFALKALPARTAVVGAGYIAVE
IAGVLHALGSQTHLFLRQNSALRGFDPLLSQTLMEIMEAEGPAVHRQATPKAVVRNADGS
LDLQLQDGSSHTVDCVVWAVGRRPDTSGLNLEAAGVALQDSGHIAVDKFQDTNVPGIHAV
GDITGRIELTPVAVAAGRRLSERLFNGKTGEHLDYDNVPTVVFSHPPIGTVGLTEPQARE
RFGDDQVKVYQSAFTAMYTAVTRHRQPARMKLVCVGPEERIVGIHGIGLGMDEMLQGFAV
ALKMGATKRDFDDTVAIHPTAAEEFVTMR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaagcactacgactacatcgtcatcggcggcggcagcggcggcattgcatcggccaac
cgcgccgccatgcacgggcgccactgcgcgctgatcgaagccggcgagatcggcggcacc
tgcgtcaacgtgggctgcgtgcccaagaaggtcatgtggcatgcggcccagatcggcgaa
gccatgcaccgctacggccccgactacggctgggatgccaccgtcaaccgcctggactgg
cagcgcctgctggacagccgcagcgcctacatcgaccgcatccatgcctcgtatgaaagc
ggcctggcgcgcaacaaggtcgagctgatccagggctttggccgcttcgtggatgcacgc
accgtggaggtgggcggccagcggctcagtgccgatcacatcctcattgccacgggcacg
cgcccggcacggcccgacattccgggcgccgagctgggcatcgactccgacggcttcttc
gccctcaaggccctgcctgcgcgcacggccgtggtgggtgccggctatatcgccgtggag
attgccggcgtgctgcacgcgctgggctcgcagacccatctgttcctgcgccagaactcg
gcactgcgcgggttcgatccgctgctgagccagaccctgatggagatcatggaggccgaa
ggccccgccgtgcaccgccaggccaccccgaaggccgtggtccgcaacgcagacggcagc
cttgatctgcaactgcaggacggcagcagccacaccgtggactgcgtggtctgggccgtg
ggccgcaggcccgacacctcgggcctgaacctggaggccgcgggcgtggcgctgcaggac
agcggccacatcgcggtggacaagttccaggacaccaatgtgcccggcatccacgccgtg
ggcgacatcacgggccgcatcgaactcacgcccgtggccgtggccgcaggccggcggctg
tccgagcgcctgttcaacggcaagacgggcgagcacctggactacgacaacgtacccacc
gtggtcttcagccacccacccatcggcaccgtgggcctgaccgagccgcaggcacgcgag
cgctttggcgacgatcaggtcaaggtctaccaatcggccttcaccgccatgtacacggcg
gtcacgcgccaccgccagcccgcgcgcatgaagctggtctgcgtgggccccgaggaacgc
atcgtgggcatacacggcataggcctggggatggacgagatgctgcagggctttgcagtg
gcgctcaagatgggtgccaccaagcgcgacttcgacgacaccgtggccatccaccccacg
gcggccgaggagttcgtgaccatgcgctga

DBGET integrated database retrieval system