KEGG   Delftia sp. HK171: BO996_12115
Entry
BO996_12115       CDS       T04584                                 

Definition
(GenBank) desaturase
  KO
K21677  hydroxysqualene dehydroxylase [EC:1.17.8.1]
Organism
dhk  Delftia sp. HK171
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BO996_12115
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.8  With a flavin as acceptor
    1.17.8.1  hydroxysqualene dehydroxylase
     BO996_12115
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 DAO FAD_oxidored GIDA FAD_binding_2 HI0933_like
Other DBs
NCBI-ProteinID: APE51583
LinkDB
Position
complement(2703626..2705014)
AA seq 462 aa
MSRDSAKHTPRAAQPRAAILGGGWAGFAAALTLARSGWHITLHEAAREPGGRARGMDLDT
PQGPLRVDNGQHILIGAYTESLRLMREVGVDPERALHRQPMALPYADGSGLRFPDWPAPL
EALAGIATARGWSLGERAALLARAVRWRLAGFRCAPQATVADLCAGLPQRLVTEFIDPLC
ISALNTPIHLASGTVFLRVLRDALFSGRGGSHFLVPRRDLGSLFPAPAAQWLQERGHAVR
LGSRVAELQPQGPHWTLGAAQAEDAPFDAVLLACPAPEAARLALTAAEHDSLPARDGIAL
QRWAQLAQDLQHRPIATVYAQAFDASHTLPPGAPWLALRSTPDAPAQFVFDRGQLGGPQG
LMAFVISDSASDRETLQAQVLAQARAQLGWHGLVALRTVIDKRATFACLPQLQRPGMELG
HGLWACGDHVDGPYPATIEGAVRSGLQAAEAIGQALGAEGKA
NT seq 1389 nt   +upstreamnt  +downstreamnt
gtgagcagagacagcgccaagcacacgcctcgcgccgctcagccgcgcgccgccatcctc
ggcggaggctgggccggctttgccgccgccctcacgctggcgcgcagcggctggcacatc
acattgcacgaggccgcacgcgagcccggcggccgtgcgcgcggcatggacctcgacacg
ccacagggcccgctgcgcgtggacaacggccagcacatcctcatcggtgcctacaccgaa
agcctgcgcctcatgcgcgaagtgggcgtggaccctgaacgggcgctgcaccgccagccc
atggccctcccctatgccgatggcagcggcctgcgctttcccgactggcctgcgccgctg
gaagcgctggccggcattgccaccgcacgcggctggagcctgggcgagcgtgcagccctg
ctggcgcgcgccgtgcgctggcggctggcgggatttcgctgcgcgccgcaggccaccgtg
gccgacctgtgcgccggcctgccgcagcgcctggtcaccgagttcatcgacccgctgtgc
atctcggcgctcaacacgcccattcacctggccagcggcacggtgttccttcgcgtgctg
cgcgatgcgctgtttagcggccgtggcggctcgcatttcctggtgccgcgccgtgacctg
ggcagcctgttcccggcgccggccgcgcagtggctgcaagagcgcggccacgccgtgcgc
ctgggcagccgcgtcgcagaactgcagccccagggcccgcactggacgctgggcgcagcc
caggccgaagacgcgcccttcgacgccgtgctgctggcctgccccgcgcccgaggcggcg
cgcctggcactcaccgccgcagagcacgacagcctgcctgcacgcgacggcatagccctg
cagcgctgggcgcagctggcccaggacctgcagcaccgccccattgccaccgtctatgcg
caggcctttgacgcctcgcacacattgcccccgggcgcgccctggctggcgctgcgctcc
acgcccgatgcacctgcgcaattcgtcttcgaccgtgggcaactcggcggcccgcagggc
ttgatggccttcgtcatcagcgacagcgcatcggaccgcgaaaccctgcaggcccaggtg
ctggcccaggcccgggcgcagttgggctggcatggactggttgcgctgcgcaccgtgatc
gacaagcgcgccaccttcgcctgcctgccgcagctgcagcgccccggcatggagttgggc
cacggcctgtgggcctgcggcgaccatgtggatggaccgtatccggccaccatcgaaggc
gccgtgcgcagcggcctgcaggcggccgaggccatcggacaggccctgggagccgaggga
aaagcctga

DBGET integrated database retrieval system