KEGG   Delftia sp. HK171: BO996_15795
Entry
BO996_15795       CDS       T04584                                 

Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00010  Glycolysis / Gluconeogenesis
dhk00020  Citrate cycle (TCA cycle)
dhk00260  Glycine, serine and threonine metabolism
dhk00280  Valine, leucine and isoleucine degradation
dhk00310  Lysine degradation
dhk00380  Tryptophan metabolism
dhk00620  Pyruvate metabolism
dhk00630  Glyoxylate and dicarboxylate metabolism
dhk00640  Propanoate metabolism
dhk01100  Metabolic pathways
dhk01110  Biosynthesis of secondary metabolites
dhk01120  Microbial metabolism in diverse environments
dhk01200  Carbon metabolism
Module
dhk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dhk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dhk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BO996_15795
   00020 Citrate cycle (TCA cycle)
    BO996_15795
   00620 Pyruvate metabolism
    BO996_15795
   00630 Glyoxylate and dicarboxylate metabolism
    BO996_15795
   00640 Propanoate metabolism
    BO996_15795
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BO996_15795
   00280 Valine, leucine and isoleucine degradation
    BO996_15795
   00310 Lysine degradation
    BO996_15795
   00380 Tryptophan metabolism
    BO996_15795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dhk04147]
    BO996_15795
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BO996_15795
Exosome [BR:dhk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BO996_15795
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA Pyr_redox_3 HI0933_like FAD_oxidored FAD_binding_2 3HCDH_N AlaDh_PNT_C FAD_binding_3 Thi4 NAD_binding_8 Lycopene_cycl DAO
Other DBs
NCBI-ProteinID: APE49198
UniProt: A0A542ZYG0
LinkDB
Position
3546010..3547437
AA seq 475 aa
MSKQFDVIVIGAGPGGYIAAIRAAQLGFNVACIDEWKNAAGGAAPGGTCTNVGCIPSKAL
LQSSEHFEHANLHFADHGISTGKVEMDVAKMIARKDAVVKQNNDGILYLFKKNKVTFFHG
RGSFVKAVEGGYEIKVAGKEEEVLTGKQIVVATGSSARALPGVPFDEENILSNDGALRLG
KAPKKLALIGAGVIGLEMGSVWRRLGTEVVVLEGMDKFLSAVDEQIAKEAKKAFDKQGLK
IELGVKIGEIKSGKKGVSIAYTNAKGEAQALEADKLIISIGRTANTAGLNAEAVGLALDE
RGCVVVDDDCKTSLPGVWAVGDVVRGPMLAHKAEEEAVAVAERIAGQHGHVNFGTIPWVI
YTSPEIAWVGRTEQQLKEQGVKYKAGTFPFLANGRARALGDTTGMVKFLADAETDEILGV
HMVGPMVSELISEAVVAMEFKASSEDIARICHAHPSLSEATKEAALAVDKRTLNF
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgagcaagcaattcgacgtcatcgtcatcggcgcgggccctggcggctacatcgccgcc
atccgtgccgcacaactgggcttcaacgtggcctgtatcgacgagtggaagaacgccgct
ggcggcgccgctccgggcggcacctgcaccaacgtgggctgcattccctccaaggccctg
ctgcagtcgtccgagcacttcgagcacgccaatctgcactttgccgaccatggcatctcc
accggcaaggtcgagatggacgtggccaagatgatcgcccgcaaggatgcggtcgtgaag
cagaacaacgacggcatcctgtacctgttcaagaagaacaaggtcaccttcttccacggc
cgtggctcgttcgtcaaggcggtcgagggcggctacgagatcaaggttgccggcaaggaa
gaggaagtgctgacgggcaagcagatcgtggtcgccacgggctccagcgcccgcgcgctg
cccggcgtgcccttcgatgaagagaacatcctgtccaacgacggcgccctgcgcctgggc
aaggcccccaagaagctggccctgatcggcgccggcgtgatcggcctggaaatgggctcg
gtctggcgccgcctgggcacggaagtggtcgtgctcgaaggcatggacaagttcctgtcc
gccgtggacgagcagatcgccaaggaagccaagaaggcgttcgacaagcagggcctgaag
atcgagctgggcgtgaagatcggcgaaatcaagagcggcaagaagggcgtgtccatcgcc
tacaccaacgccaagggtgaagcccaggcgctggaggccgacaagctgatcatctccatc
ggccgcaccgccaacacggccggcctcaatgccgaggccgtgggcctggcactggacgag
cgcggctgcgtcgtggtcgatgacgactgcaagaccagcctgcccggcgtctgggccgtg
ggcgacgtggtgcgcggcccgatgctggcgcacaaggccgaggaagaggccgtggccgtg
gccgagcgcattgctggccagcatggccatgtgaacttcggcaccattccctgggtgatc
tacaccagccccgaaatcgcatgggtgggccgcaccgagcagcaactgaaggagcagggc
gtcaagtacaaggctggcaccttccccttcctggccaacggccgtgcgcgcgccctgggc
gataccacgggcatggtcaagttcctggccgatgccgagaccgacgaaatcctgggcgtg
cacatggtcggcccgatggtctcggagctgatctccgaagccgtggtcgccatggagttc
aaggcatcgagcgaagacatcgcccgcatctgccacgcccacccctcgctgtccgaggcc
accaaggaagcggccctcgccgttgacaagcgcactctgaatttctga

DBGET integrated database retrieval system