KEGG   Delftia sp. HK171: BO996_17975Help
Entry
BO996_17975       CDS       T04584                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dhk  Delftia sp. HK171
Brite
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BO996_17975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: APE51663
LinkDB All DBs
Position
4072229..4072867
Genome map
AA seq 212 aa AA seqDB search
MPLNASQSSHAATSQPSTPSTAVKLLMAAGMVLALGACGSQPKPPAAASASTPAAVTTAP
ASRNVAMAQLQPTQGSKVSGSLQFTAQADGSVRVQGSVQGLAPNSEHGFHVHEKGDCSSP
DGLSAGGHFNPTGQAHGRFDSSTHHTGDLPSLRSDAQGMASIDFVSRGLALDQGPNSVVG
RGLIVHKDPDDYTTQPTGNSGARLACAVITRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgaacgcttcccaatccagccacgccgccacttcgcagccctccaccccgtcc
accgccgtgaagctgttgatggctgccggcatggtgctggccctgggcgcctgtggcagc
cagcccaagcctcctgccgcagcctccgcatcgaccccggcagccgtcacgacagcgccc
gcctcccgcaatgtggccatggcccagctgcagcccacgcaaggcagcaaggtcagcggc
agcctgcagttcacggcacaggccgatggcagcgtgcgcgtgcaaggctccgtccagggg
ctggcgccgaacagcgagcacggctttcacgtccatgaaaaaggcgattgctccagccct
gacggcctgagcgctggcggccatttcaacccgaccggccaggcccatggccgcttcgat
tcttccacccatcacacgggcgacctgcccagcctgcgatccgatgcgcaaggcatggca
agcatcgacttcgtgtcgcgcggcctcgcattggaccagggccccaacagcgtggtgggt
cgtggcctgatcgtgcacaaggacccggacgactacaccacgcagcccaccggcaattcg
ggggcgcgcctggcctgtgcggtgatcacgcgcggatga

DBGET integrated database retrieval system