KEGG   Delftia sp. HK171: BO996_20530
Entry
BO996_20530       CDS       T04584                                 

Definition
(GenBank) thioredoxin reductase
Organism
dhk  Delftia sp. HK171
SSDB
Motif
Pfam: Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_2 NAD_binding_8 FAD_oxidored Pyr_redox Lycopene_cycl NAD_binding_9 Pyr_redox_3
Other DBs
NCBI-ProteinID: APE50044
LinkDB
Position
4657046..4657945
AA seq 299 aa
MKHVDFAVIGGSYAGLSAALQLARARRQVLVVDAGLRRNRFVDQAGETSHGFLTQDGVAP
AQIAAQARQQLMAYPTVQWLDGTAEDARVAPDGRLEFHAAGTAISAARIVLALGVHDSLP
PVPGLAERWGRSVFHCPYCHGYEMNAGRIGIIASSALAHHHAVMLPDWGQTTLLLNGAYK
PAAEELSTLARRGTQVESTPIARLEGRADVVLQDGRRLVMDGLFTQPRTRIASPVAEQLG
CALEEGPMGTFIKVAEGQATSVPNVFACGDAARAAGNVAMAVSDGAMAGIGAHRSMMGW
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaaacacgttgatttcgccgtcatcggcggcagctatgccggcctgtccgccgcgctg
caactggcgcgtgcgcgccgccaggtgctggtggtcgatgccgggctgcggcgcaaccgc
ttcgtggaccaggccggcgagacatcgcacggctttctcacccaggatggcgtggccccc
gcccagatcgccgcccaggcccggcagcagctgatggcctatcccaccgtgcagtggctg
gacggcacggccgaggacgcccgcgtggcgcccgatggccggctggagttccatgcagcg
ggcacggccatcagcgccgcccgcatcgtcctggcgctgggcgtgcatgacagcctgccg
cccgtgccgggactggccgagcgctggggccgcagcgtctttcactgcccgtactgccac
ggctacgagatgaatgcggggcgcatcggcatcatcgccagctcggccctggcccaccac
cacgccgtcatgctgcccgactggggccagaccacgctgctgctcaacggcgcctacaag
cccgccgccgaagaactttccacccttgcgcgccggggcacccaggtggagtccacgccc
atcgcccgcctggaaggccgggccgacgtggtgctgcaggatggccgccgcctggtgatg
gacggcctgttcacccagccgcgcacccgcatcgccagccccgtggccgagcagttgggc
tgcgccctggaagaaggccccatgggcaccttcatcaaggtcgcggaaggccaggccacc
agcgtccccaacgtgttcgcctgtggcgacgcggcccgcgcggccggcaacgtggccatg
gcggtgagcgatggcgccatggcaggcattggcgcgcaccggtcgatgatggggtggtga

DBGET integrated database retrieval system