KEGG   Delftia sp. HK171: BO996_21165
Entry
BO996_21165       CDS       T04584                                 

Definition
(GenBank) ferredoxin--NADP(+) reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BO996_21165
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BO996_21165
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 HI0933_like NAD_binding_8 DAO FAD_binding_3 NAD_binding_9 FAD_oxidored FAD_binding_2 Mqo
Other DBs
NCBI-ProteinID: APE50159
LinkDB
Position
4791144..4792196
AA seq 350 aa
MQDTSGTQPIQTDALVIGAGPAGLFQVFQLGLQGIRCHVVDALPHVGGQCAQLYGDKPIY
DIPGIPVCTGHELVQLLQRQIAPMDAQLHLSQQVARLQRMDDGRWLAQTSQGLELHARSV
FIAAGVGAFVPKALKVPGVELLAAGQLHYHPADLEMVRGQTAIVHGGDEEAVAAAIACAD
RAQATYLLYRRDAFQASAALLERLQELRDSGAIRVVIGQITQLYADAGQLRAVQWMDGEG
QEHELAAQQLVVCLGISPRLGPVAEWGLAMERKQLLVNPATQATDAPGIYAIGDIVSYPG
KHKLILCGFHEATMAAFAAAEYLQGEKPLLQYTTTSARLHAILGVSHPQA
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcaagacacctccggcacgcaaccgatccagaccgatgccctcgtcataggcgcgggc
ccggcgggcctgttccaggtgtttcagctgggcctgcaaggcattcgctgccatgtcgtc
gatgccctgccccatgtgggcgggcagtgcgcgcagctgtacggcgacaagcccatctac
gacattcccggcattccggtatgcacgggccatgaactggtccagctgctgcagcggcag
atcgcgcccatggatgcgcaactgcacctttcccagcaggtcgcccggctgcagcgcatg
gacgatggccgctggctggcgcagacctcgcaaggccttgaactgcacgcgcgcagcgtc
ttcattgcggctggcgtgggcgcctttgtgcccaaggcgctgaaggtgcccggcgtggag
ctgctggctgcaggccagcttcactaccatcctgccgatctggaaatggtgcgcggtcag
accgccatcgtccacggtggcgacgaagaggccgtggccgcagccattgcctgcgccgat
agggcccaggccacctacctgctctaccgccgcgacgccttccaggcttcggccgcactg
ctggagcgcctgcaggagctgcgcgacagcggcgccatccgcgtggtgatcggccagatc
acgcaactgtatgccgatgcaggccaactgcgcgccgtgcagtggatggatggcgaaggc
caggagcacgaactggcggcgcagcaactggtcgtctgcctgggcatctccccccgcctg
ggcccggtcgccgaatggggcctggccatggaacgcaagcagctgctggtgaaccccgca
acccaggccaccgatgcgccaggcatctatgcgattggcgacatcgtcagctacccgggc
aagcacaagctgatcctgtgcggcttccatgaagccaccatggcggcctttgccgccgcc
gagtatctgcagggcgaaaaaccgctgctgcagtacacgacgaccagcgcacggctgcac
gccatccttggcgtttcccacccgcaggcatga

DBGET integrated database retrieval system