KEGG   Delftia sp. HK171: BO996_22110Help
Entry
BO996_22110       CDS       T04584                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BO996_22110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dhk02000]
    BO996_22110
Enzymes [BR:dhk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BO996_22110
Transporters [BR:dhk02000]
 Other Transporters
  Pores ion channels [TC:1]
   BO996_22110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 DUF1231
Motif
Other DBs
NCBI-ProteinID: APE50322
LinkDB All DBs
Position
5021268..5021888
Genome map
AA seq 206 aa AA seqDB search
MTTLKLYYAPGTCALATRIALIEANAPHEVIKLDFPKGEQRSPEYLAINPKGRVPALVTE
RGVLTETPALLAYVARRFPEARLAPLDDAYAFAHMQDFHSYLSSTVHVAHAHGRRAGRWA
DDEAAIASMQRKVAANMAECFGVIERHYLGDAPWVLGSDYSVADAYLFTIAGWLEGDGVD
IAGFPKVQAHFKRMGERAAVRGALGS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcaagctctactacgcgcccggcacctgcgccctggccacccgcatcgcc
ctgatcgaagccaatgcgccgcacgaagtcatcaagctcgacttccccaagggcgagcag
cgcagccccgaatacctggccatcaatcccaagggccgcgtgcccgccctggtgaccgag
cgcggcgtgctcaccgaaacgcctgccctgctcgcctacgtcgcgcgccgcttccccgag
gcccggctcgccccgctcgacgatgcgtatgcctttgcccacatgcaggatttccacagc
tacctgtcctccaccgtgcacgtggcccatgcccacgggcgccgcgcaggccgctgggcc
gatgacgaagcggccattgcctccatgcagcgcaaggtggcagccaacatggccgaatgc
tttggagtgatcgaacgccattacctgggcgatgccccctgggtgctgggctcggactat
tccgtggccgacgcctatctgttcaccattgccggctggctggaaggcgacggcgtggac
atcgccggcttccccaaggtgcaggcgcatttcaagcgcatgggcgagcgcgctgccgtg
cgcggggcgctgggaagctga

DBGET integrated database retrieval system