KEGG   Delftia sp. HK171: BO996_23370Help
Entry
BO996_23370       CDS       T04584                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dhk  Delftia sp. HK171
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BO996_23370
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BO996_23370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 DAO NAD_binding_8 AlaDh_PNT_C FAD_binding_3 Glutaredoxin Thi4 DSBA K_oxygenase Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: APE50548
UniProt: A0A543AHH9
LinkDB All DBs
Position
complement(5314330..5315886)
Genome map
AA seq 518 aa AA seqDB search
MLDNNLKAQLQAYLERLQRPVELVASLDDSQGARELKELLLEIRELSDKITVVEHNDAEV
RKPSFLITNPGVDSGVRFAGVPLGHEFTSLVLALLQVGGHPSKESAELLEQVRNIDVPLH
FETYYSLSCHNCPDVVQALNLMSVLNPKISHTAIDGGLFQKEVEQREVMGVPTVFVNGER
FGQGRMELAEIVAKVDTGAASREAAKISAKDAFDVLIVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTVDIENFISVSKTEGPQLAAAMERHVRDYEVDIMNLQTASKLIPAATEG
GLIEVQTASGASLKAKTVILSTGARWRNMNVPGEDKYRTKGVTYCPHCDGPLFKGKNVAV
IGGGNSGVEAAIDLAGIVRSVTLLEFASELKADAVLQKKLRSLPNVTVILNAQTTEVNGD
GKKVTGLTYKDRTTEEVKTVALEGIFVQIGLLPNTDWLKGTVELTRFGEIVIDAKGHTSV
PGVFGAGDCTNVPYKQIIIAAGAGSTAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacaacaacctgaaagcccaattgcaggcctacctggagcgcctgcagcgtccg
gtggagctggtggcttcgctggatgacagccagggtgcgcgcgagctgaaggaactgctg
ctggaaatccgcgagctgagcgacaagatcaccgtcgtcgagcacaacgacgccgaggtg
cgcaagccctcgttcctgatcaccaatcccggcgtggacagcggcgtgcgtttcgcaggc
gtccccctgggccatgaattcacctcgctggtgctggccctgctgcaggtcggcggccat
ccgtccaaggaatcggccgagctgctggagcaggtgcgcaatatcgacgtgccgctgcac
ttcgagacctattactcgctgtcctgccacaactgtcccgacgtggtgcaggcgctgaac
ctgatgtccgtgctcaatcccaagatcagccataccgccatcgacggcgggctgttccag
aaggaagtcgagcagcgcgaagtcatgggcgtgcccaccgtctttgtgaacggcgagcgc
ttcggccagggccgcatggagctggccgagatcgtcgccaaggtcgataccggcgccgct
tcgcgtgaagcggccaagatttccgccaaggatgccttcgacgtgctgatcgtcggcggc
ggcccggccggcgccgcggctgccatctatgcggcacgcaagggcatccgcaccggcatc
gccgccgagcgcttcggtggccaggtgctggacaccgtggacatcgagaacttcatctcg
gtctccaagaccgaaggcccgcaactggccgccgccatggagcgccatgtgcgcgactac
gaggtggacatcatgaacctgcagacggcgtccaaactgattccggccgccacggaaggc
gggctgatcgaggtgcagaccgcctcgggcgccagcctcaaggccaagacggtcatcctc
tcgaccggcgcgcgctggcgcaacatgaatgtgccgggcgaggacaagtaccgcaccaag
ggcgtgacctactgcccgcactgcgacggtcccttgttcaagggcaagaatgtggccgtg
atcggcggcggcaattcgggcgtggaagcggccatcgacctggccggcatcgtgcgcagc
gtgacgctgctggagttcgccagcgagctcaaggccgacgccgtgctgcaaaagaagctg
cgcagcctgcccaacgtcacggtcatcctcaacgcccagaccaccgaggtcaacggcgat
ggcaagaaggtcaccggcctgacctacaaggaccgcacgacggaagaggtcaagaccgtg
gcgctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgactggctcaagggc
acggtggagctgacacgcttcggcgagatcgtgatcgacgccaagggccacaccagcgtg
cccggcgtgttcggcgcaggcgactgcaccaacgtgccgtacaagcagatcatcattgct
gccggtgccggctccacggctgcactgtcggccttcgatcacctgatccgccactga

DBGET integrated database retrieval system