KEGG   Delftia sp. HK171: BO996_24925
Entry
BO996_24925       CDS       T04584                                 

Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
dhk  Delftia sp. HK171
Pathway
dhk00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:dhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BO996_24925
Enzymes [BR:dhk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BO996_24925
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored HI0933_like NAD_binding_7 AlaDh_PNT_C Thi4 Trp_halogenase K_oxygenase Hema_HEFG NAD_binding_8
Other DBs
NCBI-ProteinID: APE50829
UniProt: A0A543AEC5
LinkDB
Position
5661436..5662389
AA seq 317 aa
MSSTQHAKVLILGSGPAGYTAAIYAARANLNPLLVTGMAQGGQLMTTTEVDNWPADVNGV
QGPELMQRFLEHAERFKTQVVFDHIHSVDFSKRPFTLTGDSGTYTCDSLIIATGASAKYL
GLPSEEAFMGRGVSGCATCDGFFYREQPVCVVGGGNTAVEEALYLSNIASKVTLVHRRDK
FKAEPILVDKLMDKVRAGKIELKTHFVLEEVLGDQSGVTGIRIKSTQDGHAEDIQLQGCF
IAIGHAPNTEIFKGHLEMDETGYIITQGGLKGFATQTSVPGVFAAGDVQDHVYRQAITSA
GTGCMAALDAQRFLEQE
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtcttctacccaacacgccaaagtcctgatcctcggctccggccctgccggctacacg
gccgccatctatgccgcgcgcgccaacctcaacccgctgctggtgaccggcatggcccag
ggcggccagctgatgacgacgaccgaggtggacaactggcctgcagacgtgaacggcgtg
cagggccccgagctgatgcagcgttttctggagcacgcagagcgcttcaagacccaggtg
gtgttcgaccacatccacagcgtcgatttctccaagcgccccttcacgctgaccggcgac
tccggcacctatacctgcgacagcctgatcatcgccaccggcgcctcagccaagtacctg
ggcctgccctccgaagaggccttcatgggccgcggcgtctccggctgcgccacctgcgac
ggtttcttctaccgtgagcagcccgtgtgcgtggtcggcggcggcaacacggccgtcgag
gaagccctgtacctgtccaacatcgccagcaaggtcaccctggtgcaccgccgcgacaag
ttcaaggccgagcccatcctcgtggacaagctcatggacaaggtccgggccggcaagatc
gagctcaagacccacttcgtgctcgaagaggtgctgggcgaccagtccggcgtgaccggc
atccgcatcaagagcacccaggacggccacgccgaggacatccagctgcagggctgcttc
atcgccatcggccatgcgcccaataccgagatcttcaagggccacctggagatggacgag
accggctacatcatcacccagggcggcctcaagggctttgccacgcagaccagcgtgccc
ggcgtgttcgcggctggcgacgtgcaggaccatgtctaccgccaggccatcaccagcgcc
ggcacgggctgcatggccgcgttggacgcccagcgcttcctcgaacaggaataa

DBGET integrated database retrieval system