KEGG   Delftia sp. HK171: BO996_25300Help
Entry
BO996_25300       CDS       T04584                                 

Definition
(GenBank) ferredoxin
Organism
dhk  Delftia sp. HK171
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_7 Fer4 Fer4_9 Fer4_10 Fer4_21 Fer4_16 Fer4_2 Fer4_3 GF_recep_IV Fer4_4 Tsg Fer4_17 Fer4_6
Motif
Other DBs
NCBI-ProteinID: APE50893
UniProt: A0A543AEP4
LinkDB All DBs
Position
complement(5746382..5746645)
Genome map
AA seq 87 aa AA seqDB search
MALMITDECINCDVCEPECPNDAISMGEEYYEIEHSKCTECVGHFDEPQCVQICPVACIP
VNPAHVEDRETLMQKYLRLQSQAPASS
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggctttgatgatcaccgacgaatgcatcaactgcgatgtctgcgagcccgagtgcccg
aacgatgcaatctccatgggcgaggagtactacgagatcgagcacagcaagtgcacggag
tgcgtgggccatttcgatgagccccagtgcgtgcagatctgcccggtggcctgcattccc
gtgaatcccgcccatgtggaagaccgcgagacgctgatgcagaagtacctgcgtctgcag
tcccaggctcccgcttcttcctga

DBGET integrated database retrieval system