KEGG   Dialister hominis: Dia5BBH33_11260Help
Entry
Dia5BBH33_11260   CDS       T06439                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dho  Dialister hominis
Brite
KEGG Orthology (KO) [BR:dho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dia5BBH33_11260
Enzymes [BR:dho01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Dia5BBH33_11260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 HI0933_like GIDA Lycopene_cycl Thi4 FAD_oxidored NAD_binding_8 NAD_binding_9 FAD_binding_3 DAO AlaDh_PNT_C HD_5 FMO-like
Motif
Other DBs
NCBI-ProteinID: BBK25191
UniProt: A0A510GDR0
LinkDB All DBs
Position
complement(1206206..1207126)
Genome map
AA seq 306 aa AA seqDB search
MDITDVIVIGAGPAGLNAALYASRKELSVKIISNDIGGQMLLTSEIENYLGFESISGFDL
ADKMEAHVRKYPVEFITAAVMNLEKNEDGNFVLHLDDGNTVVGKVCIITAGKHSRTLDIP
GEAKFTGRGVSYCATCDAPFYRNKTVAIVGGGDSAVQAAVELGHLCPKVYLVVRSRIKAA
EIMVKRMEELPNVEALIGYVPEEVKGDKKVNALVVKRKSDGEERELAVDGVFVEAGGIPN
NSYLPEDVKTNSMGEIITNKDGETNIPGLYAAGDVTDCKNKQIIIAVGEGAAAALAAHDY
LLRSGK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatattactgacgttattgtgattggtgctggtcctgcaggtctgaatgctgcttta
tacgcttcccgcaaggagctcagcgtaaaaattatttcaaatgatatcggcggacagatg
cttctgaccagtgaaattgaaaattatctcggattcgaatcaatttccggttttgatctg
gcagacaagatggaagcacatgtaaggaaatacccggttgaatttatcaccgcggccgtc
atgaatcttgaaaagaatgaagatggaaatttcgtccttcatctggatgatggaaatacc
gtcgtcggaaaggtctgcattattacagcaggaaagcacagccgcacgctggatataccg
ggagaagccaaatttacaggccgcggcgtatcttattgtgccacctgtgatgctccgttc
taccgcaataagactgttgccattgtcggcggcggggacagcgctgtacaggctgctgta
gaattaggacatctttgcccgaaggtgtacctggtggtcagaagccgcatcaaagcagct
gaaatcatggtcaaacgcatggaagaactgcctaatgtagaagctcttatcggttatgtt
cctgaagaagtcaagggtgacaagaaggtgaatgcccttgtcgtaaaacgcaagagtgat
ggagaagagcgtgaacttgccgtcgatggtgtctttgtagaagcaggcggcattccgaat
aattcctatcttccagaagacgtgaagactaacagcatgggagaaatcataaccaataag
gacggagagacaaacattcccggcctttatgcagctggtgatgtcacagactgcaagaac
aagcagatcattattgctgtaggagagggggctgccgcagcattagccgctcacgactac
ttgctgcgaagcggtaaatga

DBGET integrated database retrieval system