KEGG   Desulfovibrio hydrothermalis: DESAM_20083Help
Entry
DESAM_20083       CDS       T02428                                 

Gene name
glpD
Definition
(GenBank) FAD dependent oxidoreductase/Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00564  Glycerophospholipid metabolism
dhy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dhy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DESAM_20083 (glpD)
Enzymes [BR:dhy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DESAM_20083 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_3 HI0933_like Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: CCO22374
UniProt: L0R6N4
LinkDB All DBs
Position
complement(363572..365137)
Genome map
AA seq 521 aa AA seqDB search
MKRSDFIQQMDDSSRVWDFIIIGGGATGLGSGLDAAARGYSVLLLEQGDFAEATSSRSTK
MVHGGVRYLAQGNISLVMGALRERGILRKNAPHMCYNQKFVVPDYKWWGLPYYGIGLKTY
DLLAQKYSFGASRILSARKVQKEIPGVLTHKLKGGVTYHDGQFDDARLALTLARTMADMG
GCPLNYTRVTGLVKDSSGYVCGVQAEDKISGKSYELKAKAVINATGIFTDDVMNMDNADH
KKLIAPSQGIHIVIDREFLGGETGIMVPKTDDGRVIFFVPWHGKVVVGTTDTPISSVCME
PKPLEEEIDFLVEHSARYLSKPLKRSDVRSVFVGIRPLIAASSKGNKTSALSRDHYLTVS
PNKLLTIAGGKWTTYRHMGEDCIDHAIKMGGHTFRPSPTKHLKLHGYTEDFDHNDHMHVY
GSEAAEIKALASEFPELDCPMHEKLPYSWLEVVWAARHEWAQTVYDVLSRRTRALILDAK
VAVEVAPKAAEILAKELGKDDKWVKEQIEQFTLLSDIYVVK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcagattttatccaacagatggatgacagttccagagtatgggactttatc
attatcgggggcggagcaacgggcctgggttccgggctggacgctgctgctagagggtat
tcagtacttttacttgagcaaggtgattttgccgaagctacttccagccgcagtacgaaa
atggtgcacggcggagtccggtatcttgcgcagggaaacatttctctggttatgggagct
ttgcgtgagcgcggaattctccgtaagaatgctccgcatatgtgctataatcagaaattt
gtggttccggattataaatggtgggggctgccttactatggaatagggcttaaaacctac
gatctgcttgctcagaagtacagcttcggggcatctaggattctttcagcccgcaaggtt
caaaaagaaatccccggtgttttgactcataaacttaaaggcggcgtgacctatcacgac
ggtcagtttgatgatgcccgtctggccctcactcttgcccgcactatggctgatatgggc
ggctgtcctttgaactacacccgtgtgaccggtctggttaaagattcttccggttatgtc
tgcggagttcaggctgaagataaaatcagcggtaagtcttatgagttgaaagcaaaagcg
gttataaacgctaccggcatcttcactgatgatgtcatgaacatggataatgccgaccat
aaaaagcttatagctcccagtcaggggattcatatagttatagatcgtgaatttctcggt
ggtgagaccggtattatggttcctaagactgatgatggacgtgtaatctttttcgttccg
tggcatggaaaggttgttgtaggaacaactgacactcctatctcctctgtgtgtatggag
ccgaagcctctggaagaagaaattgactttttagttgaacattctgcaaggtatttaagc
aaacctcttaaacgttctgatgttcgcagcgtttttgtaggaataaggcccttgattgct
gcaagcagcaaagggaacaaaacctctgcattatccagagatcattacttgaccgtttcc
cccaataagctgctgactattgctggcggtaagtggactacctatagacatatgggtgaa
gattgtatcgaccatgcaatcaaaatgggcggccatacattccgtccctctcctaccaag
catttgaaactgcatggttatactgaagattttgatcataatgaccacatgcatgtttac
ggaagtgaagctgcggaaattaaagctcttgcttcagagtttcctgaacttgactgtcca
atgcatgaaaagcttccttactcatggcttgaagttgtctgggcagctcgtcatgaatgg
gctcagaccgtgtatgatgttctttcccgtagaacaagagctttgattctggatgcaaaa
gttgcagtagaagttgctccgaaagctgctgagattcttgctaaggaacttggtaaagat
gacaaatgggttaaagaacagatcgaacagtttactcttttgtctgatatatatgttgta
aagtag

DBGET integrated database retrieval system