KEGG   Desulfovibrio hydrothermalis: DESAM_22043Help
Entry
DESAM_22043       CDS       T02428                                 

Gene name
glgP
Definition
(GenBank) Glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00500  Starch and sucrose metabolism
dhy01100  Metabolic pathways
dhy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DESAM_22043 (glgP)
Enzymes [BR:dhy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     DESAM_22043 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: CCO24310
UniProt: L0RDN4
LinkDB All DBs
Position
2435672..2438239
Genome map
AA seq 855 aa AA seqDB search
MQPLRVYSVVPRLPKQLNELWDLAYNFLFVWNNDIASIFSSIDQTLWRDCQQNPVSFLNH
LPQQQLEELANDDFFVQRLKEAVKVQKGYLSREGCSYKFEGAKKGDSVVAYFSFEYGIGL
SLPIYSGGLGILAGDHLKSASDLNIPLVGIGLCYQHGYFRQYMTQDGWQQERYPSHDFEE
MPIKPAKDEAGEDVIFALDMKGEELKVKIWYVQVGRVTLYLLDTNISDNPAHFRAITARL
YGGDLEMRLWQEILLGIGGVKALAALGLEPSVIHMNEGHSAFAGLERIRVFMTEQGLSFE
AAMEMVASSSIFTTHTPVPAGNDRFPADLMRPYFEPYAQTMGLAYKVFLALGREEPRNDS
EQFCMTVLALKLSRFNNGVSILHGHVSRNMWKKVWPQYPVEDVPIGAITNGVHMPTWVAT
DFSLLFDRYLGPNWREDPDCTRVWRQTDNIPDAELWRTHERLRERLVDFVRKRLRKQLLN
IGARRKEIELADEVLDPRALTIGFARRFATYKRAGLLLRDKERLIRLLADTKHPVQFIFA
GKAHPQDNEGKKLIQDLIQLCRREECRMSMVFIEDYDMKIANYMVQGCDIWLNTPRRPLE
ACGTSGMKAMANGVLQFSTPDGWWDEAYLTDNSLGWAIGRREDYNDHEYQDFVESQTLYR
VLENDIIPEFYDRGHGSLPRSWIAKVKKALRILGPEFNANRMVEDYTEKAYLPAFSNYKT
MSQNGFQGAKDLAAWRMDLMTKWSSLKVRNIVSEAHTDMYVEEPIIISAEVYLNGLTTGD
VQVEIYAGPVGQDGGFVSRKTVVMNAEEDLGSGWHLYQGEVLPGEAGRFGYTVRILPKHE
LLLDPHSLGLIYWAQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgcagccacttcgcgtatacagcgtcgtaccccgtctgcccaaacaattgaatgagctt
tgggacttggcttataactttcttttcgtatggaacaacgatatcgcgagtatcttttct
tccattgatcagactctctggcgagactgccagcagaatcctgtttcctttttgaatcat
cttcctcagcagcagcttgaggaacttgctaatgatgatttttttgttcagcgtctcaaa
gaagctgttaaagttcaaaaggggtatctttccagagaaggatgctcttacaaatttgaa
ggagctaagaaaggtgattccgttgtagcttatttcagttttgagtatggcatcggcctt
agtctccctatttattcaggaggactcggtattctggctggtgaccatcttaaatctgca
agtgatttgaatattccattggtggggatcggtctctgctatcagcatggttattttcgc
cagtatatgactcaggacggctggcagcaggaacgttatcccagccatgattttgaagaa
atgcccatcaaaccggccaaggatgaagccggtgaagatgtaatctttgctctcgacatg
aaaggcgaagagctgaaggttaaaatctggtatgtacaggtggggcgcgtaactctttac
ctgcttgataccaatatctctgataaccctgcgcattttagagcaattacagctcgcctt
tacggtggcgatcttgaaatgcggctgtggcaggagattctgcttgggatcggcggagtt
aaagctcttgccgctctgggccttgaaccgagcgttattcatatgaatgaagggcattct
gcctttgccggacttgagcggatcagggtttttatgaccgaacaggggttgtcttttgag
gctgcaatggaaatggttgcatcttccagcatttttacaacgcataccccggttccggct
ggtaatgaccgtttcccggcagatttgatgcgtccttattttgaaccatatgctcagact
atgggccttgcttataaagtttttcttgccctcggcagggaggaaccccgcaatgattct
gagcagttctgcatgacagttcttgctcttaaactttcccgttttaataacggtgtatct
attctgcatggtcatgtttccagaaatatgtggaaaaaggtctggcctcagtatccggtt
gaagatgtgccgatcggggccattaccaacggtgtgcacatgcctacatgggttgccacc
gatttttcgttactttttgaccgctatctaggccccaactggcgtgaagatcctgattgc
acaagagtgtggaggcagacggataatattcctgatgctgaactttggcgcacccatgaa
cgtttaagagaacgtcttgtggatttcgtgcgtaaaaggctgcgtaaacagctgctgaat
ataggcgcgcgcagaaaagaaattgaactcgcagatgaagttcttgatcctcgcgcactt
actatcggctttgcacgtcgtttcgccacatacaagcgcgccggactgctgcttagagat
aaggagcgtctgatcaggcttcttgcagataccaagcatcctgtgcagtttatttttgcc
ggtaaagctcatccgcaggataacgaaggtaaaaagttgattcaggatctgattcagctt
tgccggcgtgaagagtgccgcatgagcatggtttttattgaagactatgacatgaagatt
gccaactacatggtacagggttgtgatatctggctgaatacccccagacgtcctctcgaa
gcgtgcggaaccagcggtatgaaagctatggctaacggagtgctccagttcagtactcct
gacggctggtgggatgaagcatatctgaccgataacagtctcggctgggcaattggacga
cgcgaagattataacgatcatgaatatcaggattttgtggaaagccagactctttacaga
gtacttgaaaatgacataatccctgagttctacgatcgtggacacgggagcctccccaga
agctggattgccaaagtgaagaaggcactgcgtattctcggccctgaatttaacgccaac
cgcatggttgaggattatactgaaaaagcatatctgcctgcattcagtaattacaaaacc
atgtctcagaacggctttcagggggcaaaagatcttgcagcatggagaatggatctcatg
accaagtggtccagcctcaaggtcaggaatattgtttcggaagcacataccgacatgtat
gtggaagaacctattattatcagcgcagaagtctatttgaacggattaactacaggtgat
gttcaagttgaaatctatgccggtccggtaggtcaggacggaggttttgtaagcaggaag
actgtggtaatgaatgcagaagaagatctgggttccggatggcatctgtatcagggagaa
gttctgccaggtgaggccggaaggttcggttatactgtaagaattctgccgaagcacgaa
ttgctgcttgatcctcactcattgggccttatttactgggcgcaataa

DBGET integrated database retrieval system