KEGG   Acidovorax ebreus: Dtpsy_0271Help
Entry
Dtpsy_0271        CDS       T00853                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dia03012]
    Dtpsy_0271
   03029 Mitochondrial biogenesis [BR:dia03029]
    Dtpsy_0271
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dia04147]
    Dtpsy_0271
Translation factors [BR:dia03012]
 Eukaryotic Type
  Elongation factors
   Dtpsy_0271
 Prokaryotic Type
   Dtpsy_0271
Mitochondrial biogenesis [BR:dia03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dtpsy_0271
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dtpsy_0271
  Exosomal proteins of breast cancer cells
   Dtpsy_0271
  Exosomal proteins of colorectal cancer cells
   Dtpsy_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ACM31755
UniProt: B9MB71
LinkDB All DBs
Position
289235..290425
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKGYDQIDNAPEEKARG
ITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYDFPGDDTPIIRGSAKLALE
GDQSDKGEPAIMRLAEALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIRDTQKTTVTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaagtttgaacgtaccaagccccacgtgaacgtgggcacgatcggtcac
gtggaccatggcaagacgacgctgacggcggccatcgccacggtgctgtccaagaagttc
ggcggcgaagccaagggctacgaccagatcgacaacgcccctgaagaaaaggcgcgcggc
atcacgatcaacacctcgcacgtggaatacgaaacggccacccgccactacgcccacgtc
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgccgctcagatggac
ggcgccatcctggtgtgctcggccgctgacggcccgatgccccagacgcgcgagcacatc
ctgctggcccgtcaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgaggaactgctcgagctggtcgagatggaagtgcgtgaactgctggacaag
tacgacttccccggcgacgacacccccatcatccgcggctccgccaagctggccctggaa
ggtgaccagtccgacaagggcgaacccgccatcatgcgcctggccgaagccctggacacc
tacatccccacgcctgagcgcgccgtggacggcgccttcctgatgcctgtggaagacgtg
ttctccatctccggccgcggcaccgtggtgaccggccgcgtcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggtatccgcgacacgcaaaagaccaccgtcaccggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtgggcctgctg
ctgcgcggcaccaagcgcgaagacgtcgagcgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcacggctgaggtgtacgtgctgagcaaggacgaaggcggt
cgtcacacgcccttcttcaacaactaccgtccccagttctacttccgcaccaccgacgtg
accggctccatcgagctgccggccgacaaggaaatggtgatgcccggcgacaacgtgtcg
atcactgtgaagctgatcaaccccatcgccatggaagaaggcctgcgcttcgctatccgc
gaaggcggccgtaccgtgggcgccggcgtcgttgccaagatcattgcgtaa

DBGET integrated database retrieval system