KEGG   Acidovorax ebreus: Dtpsy_0382Help
Entry
Dtpsy_0382        CDS       T00853                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dia  Acidovorax ebreus
Pathway
dia00564  Glycerophospholipid metabolism
dia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dtpsy_0382
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dtpsy_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 Thi4 Lycopene_cycl Pyr_redox_2 HI0933_like GIDA 3HCDH_N Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACM31866
UniProt: B9MBU6
LinkDB All DBs
Position
394369..395967
Genome map
AA seq 532 aa AA seqDB search
MTSDTSTPLATVRADLLARLAQPVTYDLAVVGGGATGLGVALDAAARGFSVVLLESHDFA
KGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLRNAPHLAQPLAFVMPSYKVWETP
FYGVGLKMYDALAGKAGLGPTEFLGRMETLRCLPTAMADGLKGGVKYWDGQFDDARLALA
LARTAAQRGALLLNYCPVDDLLYDGGKVAGVVCQDAETGQRYEVRARCVVNATGVWVDAL
RQRDGDVSGQPAKPMVAPSQGVHIVVDREFLPSDHALMVPKTADGRVLFAVPWLGKVILG
TTDSPRQDLAREPQAMREEVAFILGESARYLRRAPQASDVRSIWVGLRPLVKPSDEDAAA
TKSISREHTVLASRSGLVTVTGGKWTTYRAMAEDVLLKCMDEHLLPRRPGGITVALPLVG
AGATRERQGMNAPQGLHSYGDEAARVQALPGSQVQLAEGLSEAMVRFAARHEYARTVEDV
LARRSRVLFLDARLAAALAPRVADILREEIPGQDPQLPAFLELAAHYATVPV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactagcgacacctccacccctttggcaaccgtacgggccgacctgttggcccgcctg
gctcaacccgtgacctacgacctggcggtcgtcggaggtggggcgacgggcctgggggtg
gcgctggatgcggcggcgcgcggcttttccgtcgtgctgctggaatcgcacgacttcgcc
aagggcacctcctcgcgtgccaccaagctggtgcacggcggcgtgcgctacctcgcgcag
ggcaacatcgccctggtgcgcgaggcgctgcacgagcgcaccacgctgttgcgcaacgcc
ccccatctggcgcagccgttggcattcgtcatgccttcttacaaggtgtgggaaacgccg
ttctacggtgtgggcctgaagatgtacgacgccctggccggcaaggcgggcctggggcct
accgaattccttgggcgcatggaaaccctgcgctgcctgcccacggccatggccgacggg
ctcaagggcggcgtgaagtattgggacgggcagttcgacgacgcccgactggccctggcc
ctggcgcgtaccgccgcgcagcggggggctctgctgctcaactactgccccgtggatgac
ctgttgtacgacggggggaaggtggcgggcgtggtttgccaggatgccgagaccgggcag
cgctacgaggtgcgcgcgcgctgcgtggtcaacgccaccggcgtgtgggtggacgccctg
cgccagcgcgatggcgatgtgagcggccagcccgccaagcccatggtggcgcccagccag
ggggtgcatatcgtggtggaccgcgagttcttgccctccgaccatgcgctgatggtgccc
aagacggccgacgggcgggtgctgtttgcggtgccctggctgggcaaggtgattttgggc
acgaccgacagcccacgccaggatctggcgcgcgagccccaggccatgcgggaggaagtg
gccttcatcctgggggaatcggcgcgctacctgcggcgcgccccccaggctagcgatgtg
cgcagcatctgggtgggcctgcgtcccttggtcaagccctcggacgaagacgccgccgcc
accaagagcatcagccgggaacacaccgtgctggccagccgcagcgggctggtcaccgtg
actggcggcaagtggaccacctaccgcgccatggccgaggatgtactgctcaagtgcatg
gacgaacacctgctgccgcgccgcccgggcgggatcaccgttgcgctgcccctggtagga
gccggtgccacccgggagcgccagggaatgaacgcgccccaggggctgcattcctacggt
gacgaggccgcgcgggtgcaagcccttccgggttcgcaggtgcaactggccgaagggctc
agcgaggccatggtgcgctttgccgcgcgccatgagtacgcacgcaccgtggaggacgtg
ctcgcacggcgctcgcgcgtgctgtttctcgatgcgcgcctggcggccgcgctggcgccg
cgcgtggcggacatcctgcgcgaggaaatccccggccaggacccgcagctgcccgcgttc
ctggagttggccgcacactacgccacggtgccggtataa

DBGET integrated database retrieval system