KEGG   Acidovorax ebreus: Dtpsy_1674Help
Entry
Dtpsy_1674        CDS       T00853                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
dia  Acidovorax ebreus
Pathway
dia00550  Peptidoglycan biosynthesis
dia01100  Metabolic pathways
dia01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dtpsy_1674
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Dtpsy_1674
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dia01003]
    Dtpsy_1674
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dia01011]
    Dtpsy_1674
Enzymes [BR:dia01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Dtpsy_1674
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dtpsy_1674
Glycosyltransferases [BR:dia01003]
 Polysaccharide
  Bacterial polysaccharide
   Dtpsy_1674
Peptidoglycan biosynthesis and degradation proteins [BR:dia01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Dtpsy_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ACM33132
UniProt: B9MIW6
LinkDB All DBs
Position
1774878..1777418
Genome map
AA seq 846 aa AA seqDB search
MDLSTTLRARWARLRPALAQLLHRPERWLSAHGLVWLLAALALAGVLYVLALTPFTPGIS
DIRKAKSDQPAQLVSADGRLLAEYRWVNREWVPLETIAKPVVDALIATEDHRFYDHFGLD
WRRTLSAVVRTVGGDKQGGSTITQQLARNLYPEDIGRAPTLTRKIKEAITALKIEWLYSK
DEVLETYLNTVPFLYNAYGIEMAARTYFDKSADKLNVLESATLIGMLKGTAYYNPVLNPE
RAQARRNTVLAQMAKRGKLSQTEYERLIKRPLRIRFERQAEVAGLAPHLAQQLRRQLIDW
ADRNGYSLYSDGLVIRTTIDGRLQEMANRAVQQQGRALQGVADSAWAPRSAWGPKSALVQ
QLVRESPQYEKAVAAGAAPEEALRELLDDGSFLRTLRQSKTRVQAGFMAMDPRSGAVLAW
VGSRDYATDPFDHVQAARRQPGSTFKPFVYGAAFAMGLQPTDTLLDTAVEIPLGGKRVWR
PTDGRTPPSEEPMTLRDGLAYSKNTITAQLMQKVGPARVVQLARAMGVRESELEAVPALA
LGTSSVTLKEMVAAYGTIANGGRYLAPRVITRIEDKDGKLLEEFKPASPERALDVTAAQQ
LRDALRGVVDKGTGAAIRSRYGITADVAGKTGTTQDNTDGWFILMHPQLVAGAWAGFNDG
RITLRSDYWGQGAHSALPMVGDVFRQALRAKVIDARERFVDEEESSWIGSAAGTLRNWVY
DLFGRPTGEQAGPAGAPAPQPELPQTPAPAASGPPPEERPEITDAPLVPLQEVTPRPAPA
EPPVWVTEPDAPLPGPPAAAPAAPPAPPGAGPTAPQVVPGVVVDPVQRGVVVPRPQDNAP
FFVETR
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggatctttccacgaccctgcgagcccgctgggcccgcctgcggcccgcgctggcgcaa
ctgttgcatcggcccgagcgctggctgtccgcgcatggcctggtgtggctgctggcggcg
ctggcgctggccggcgtgctgtatgtgctggcgctgaccccgttcacgccggggatcagc
gacatccgcaaggccaagagcgaccagcctgcgcaactggtgtccgccgacgggcggctg
ctcgccgagtaccggtgggtgaaccgcgaatgggtgccgctggagaccatcgccaagccc
gtggtcgatgcgctcatcgccaccgaggaccaccgtttctacgaccacttcggcctggac
tggcggcgcacgctgtcggccgtcgtgcgcaccgtgggcggcgacaagcagggcggctcc
accatcacccagcagcttgcgcgcaatctctaccccgaggacatcggccgcgcgcccacg
ctcacgcgcaagatcaaggaggcgatcaccgcgctgaagatcgagtggctgtactccaag
gacgaggtcctggagacctacctgaacacggtgcccttcctctacaacgcctacggcatc
gagatggcggcgcgcacgtacttcgacaagtcggccgacaagctcaacgtgctggagagc
gccacgctgatcggcatgctcaagggcacggcctactacaacccggtgctcaaccccgag
cgcgcgcaggcccggcgcaacaccgtgctggcgcaaatggccaagcggggcaagctctcg
cagacggaatacgagcggctgatcaagcgcccgctgcgcatccgcttcgagcggcaggcc
gaggtggcgggacttgcaccgcacctggcgcagcagctgcgccgccagctcatcgactgg
gccgaccgcaacggctacagcctgtattccgatgggctggtgatccgcaccaccatcgac
gggcggctgcaggagatggccaaccgggccgtgcagcagcagggccgggcgctgcagggt
gtggccgacagtgcgtgggcgccgcgcagcgcctggggccccaagagcgcgctggtgcaa
cagctggtgcgcgagtcgccccagtacgaaaaggcggtggccgcgggtgccgcacccgag
gaggcactgcgcgaactgctggacgacggcagcttcctgcgcacgctgcgccagtccaag
acccgcgtgcaggccggcttcatggccatggacccgcgcagcggtgcggtgctggcctgg
gtgggcagccgcgactacgcgaccgatccgttcgaccacgtgcaggctgcgcgccgccag
ccgggctccaccttcaagcccttcgtgtacggcgcggcctttgcgatgggactgcagccg
accgacacgctgctggacaccgcggtggagatccccctgggtggaaagcgggtctggcgc
cccacggacggccgcacgccgcccagcgaggagcccatgacgctgcgcgacgggctggcg
tattccaagaacaccatcactgcacagctcatgcagaaggtggggccggcgcgcgtggtg
caactggcccgcgccatgggcgtgcgcgagtccgaactggaggccgtgcccgcgctggcg
ttgggcacgagctcggtcacgctcaaggagatggtcgccgcctacggcaccatcgccaac
ggcgggcgttacctggcgccccgggtcatcacgcgcatcgaggacaaggacggcaagctg
ctggaggaattcaagcctgcatcgcccgagcgcgcgctggacgtcaccgccgcgcagcag
ctgcgcgacgcgctgcggggcgtggtggacaaaggcacgggcgcggccatccgcagccgc
tacggcatcacggcggacgtggcgggcaagaccggcaccacgcaggacaacaccgacggc
tggttcatcctgatgcatccgcagctcgtcgcgggggcctgggcgggcttcaacgacggg
cgcatcaccctgcgcagcgactactgggggcagggcgcgcacagcgctctgcctatggtg
ggcgacgtgttccgccaggccctgcgcgccaaagtcatcgacgcacgcgagcgcttcgtg
gatgaggaggaaagctcctggatcggctcggccgcaggcacgctgcgcaactgggtctat
gacctgtttggtcgtcccacgggtgagcaggccggcccggcgggcgctccggcgccgcag
cccgaactgccgcagacgccggcgccggccgccagcggcccgccgccggaagagcgcccc
gagatcacggatgcgccccttgtgccgctgcaggaggtcacgccccgccccgcgccggcc
gagccgccggtgtgggtgaccgagccggatgcaccgttgccgggtccgccagccgctgct
ccggcggcgcccccggcgccacccggtgccggccccaccgcgccgcaggtcgttcccggc
gtggtggtcgatcccgtgcagcgtggcgtggtcgtaccccggccgcaggacaacgcgccg
tttttcgtcgaaacccgctga

DBGET integrated database retrieval system