KEGG   Acidovorax ebreus: Dtpsy_1694Help
Entry
Dtpsy_1694        CDS       T00853                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
dia  Acidovorax ebreus
Pathway
dia00010  Glycolysis / Gluconeogenesis
dia00620  Pyruvate metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_1694
   00620 Pyruvate metabolism
    Dtpsy_1694
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Dtpsy_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACM33151
UniProt: B9MJ13
LinkDB All DBs
Position
complement(1796934..1798457)
Genome map
AA seq 507 aa AA seqDB search
MNMAEIASLGIANPYKQQYGNYIGGQWVAPVDGQYFENISPINGQKFTAVPRSNSKDIDA
ALDAAHKAKAAWGRTSTTERANILNRIADRMEANLLQIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDADTIAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLMEIIGDLLPPGVVNVVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVMSADDGFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYERFMERALKRVAAIQQGHPLDKNTMIGAQASQEQLEKILSYLDLGK
QEGAQCLIGGARNTALGGDLAGGYYVQPTVFKGHNKMRIFQEEIFGPVVSVTTFKTEEEA
LEIANDTLYGLGAGVWSRDGARAFRMGKGIQAGRVWTNCYHHYPAHAAFGGYKQSGIGRE
NHKMMLDHYQQTKNLLVSYTQQPLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggccgaaatcgccagccttggcatcgccaatccctacaagcagcagtacggc
aactacatcggcgggcagtgggtggcgcccgtggacgggcagtacttcgagaacatctcg
cccatcaacggccagaagttcacggccgtgccgcgctccaacagcaaggacatcgacgcc
gcactggacgccgcgcacaaagccaaggccgcgtggggccgcacctcgaccaccgagcgt
gccaacatcctgaaccggatcgccgaccgcatggaggccaacctgctgcagatcgccgtg
gccgagaccatcgacaacggcaagccgctgcgcgagaccatggcagccgacattccgctg
gccatcgaccacttccgctacttcgccggcgccgtgcgcgcgcaggagggcggcatcagc
gagatcgacgccgacaccatcgcctaccacttccatgaaccgctgggcgtggtcgggcag
atcattccgtggaacttccccatcctgatggcggtgtggaagctcgcccccgcgctggct
gcgggcaactgcgtggtgctgaaacccgcggagcagacgcccgcctccatcttggtgctg
atggagatcattggcgacctgctgccgccgggcgtggtcaacgtggtcaacggctttggc
ctggaggccggcaagccgctggcctccagcaaccgcatcgcaaaaatagccttcaccggc
gagaccaccaccggccggctcatcatgcagtacgccagccagaacatcattcccgtgacg
ctggagctgggcggcaagagccccaacatcttctttgaggacgtgatgtccgccgacgac
ggcttcttcgacaaggcgctggaaggctttgcgatgttcgcgctgaaccagggcgaggtc
tgcacctgccccagccgcgcgttgatccaggaatcgatctacgagcgcttcatggagcgc
gcgctcaagcgcgtggccgccatccagcaaggccacccgctggacaagaacaccatgatc
ggcgcccaggcctcgcaggagcaactggaaaagatcctttcttacctggacctgggcaag
caggaaggcgcccagtgcctcatcggcggcgcgcgcaacaccgccctgggcggcgacctg
gccggcggctactacgtgcagcccacggtgttcaagggccacaacaagatgcgcatcttc
caggaggaaatcttcggccccgtggtctcggtgaccaccttcaagaccgaagaagaggcg
ctggagatcgccaacgacacgctctacggcctgggcgcgggcgtgtggagccgtgatggc
gcgcgcgccttccgcatgggcaagggcatccaggccgggcgcgtgtggaccaactgctac
caccactaccccgcgcacgccgcgtttggcggctacaagcagtcgggcatcggccgtgag
aaccacaagatgatgctggaccactaccagcagaccaagaacctgctggtgagctacacc
cagcagccgctgggcttcttctaa

DBGET integrated database retrieval system