KEGG   Acidovorax ebreus: Dtpsy_1880Help
Entry
Dtpsy_1880        CDS       T00853                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dia  Acidovorax ebreus
Brite
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dtpsy_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: ACM33337
UniProt: B9MJJ9
LinkDB All DBs
Position
2001169..2001696
Genome map
AA seq 175 aa AA seqDB search
MSLRYLPTAAALAAAIALAGCASMSSAPSATARLEPTRGNSTQGTVRFVQSGDAVRVSGT
VSGLKPGAEHGFHIHEKGDCSSGDGNSAGGHFNPTGTPHGQHGKGPHHTGDLPSLRADGN
GVATFNFESRSIRVGSGATDIVGRGLIVHANPDDYVTQPTGNAGARLACAVIAGR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttcgctacctccccacggccgcggccctggcggctgccatcgcactcgccggc
tgcgcatccatgtccagcgcgccctcggccaccgcacggctggagcctacgcgcggcaac
agcacccagggcacggtgcgcttcgtgcagagcggtgatgcggtgcgcgtcagcggcacg
gtcagcgggctcaagccgggggcggagcacggctttcacatccatgagaaaggcgactgc
tccagcggggacggcaacagcgcgggcggccacttcaatcccacgggcacaccgcacggc
caacacggcaagggaccgcaccacaccggcgacctgcccagcctgcgcgcggacggcaac
ggcgtggccaccttcaacttcgagtcgcgcagcattcgcgtgggctccggcgccaccgac
atcgtgggtcgcggcctgatcgtgcatgccaaccccgacgactacgtcacccaacctacc
ggcaacgcgggcgcgcgcctggcgtgcgcggtgatcgccggtcgctga

DBGET integrated database retrieval system