KEGG   Acidovorax ebreus: Dtpsy_2939Help
Entry
Dtpsy_2939        CDS       T00853                                 

Definition
(GenBank) histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
dia  Acidovorax ebreus
Pathway
dia02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dtpsy_2939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dia01001]
    Dtpsy_2939
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dia02022]
    Dtpsy_2939
   02035 Bacterial motility proteins [BR:dia02035]
    Dtpsy_2939
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Dtpsy_2939
Protein kinases [BR:dia01001]
 Histidine kinases
  NtrC family
   Dtpsy_2939
Two-component system [BR:dia02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   Dtpsy_2939
Bacterial motility proteins [BR:dia02035]
 Pilus system
  Twitching motility proteins
   Dtpsy_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA HATPase_c PAS_8 PAS PAS_4
Motif
Other DBs
NCBI-ProteinID: ACM34373
UniProt: B9MFM2
LinkDB All DBs
Position
3123586..3125286
Genome map
AA seq 566 aa AA seqDB search
MPSKLAAAASPLPFHRLWNAFLTARVMVALALLLLQLLGIALNQAGEPLLFSICLGYLVA
TVALRVWGHGAVPDPRPGIQWLPSIGLDLLLVSVLQALQQSGGLNFTPLFGLPVLMAGVL
GSLTLALATTAGATLLLLAWAWWLGTYGGAGDGTQRYLQAALTGTGYFIVAYLVHLLAAK
LTSEQQMARRSQMDARTHRAVSALVMQHVADGVLVLDLHGQVRLANPAALLMLGHKISGD
SSLTLTHTAAFKPLMDLACATFQMERPQHADVNVLHDGQIPMALRVRAWLTHTQDAPDDS
PGEPLCVMFLHDLREMEARLRTEKLAAMGRMSAAVAHEIRNPLAAIVQANELLDEDLDDP
TQKRLTHMVRQNADRLVRITEDVLDIARVQHQINQASSSTVALDATVQQVWNDWTAQDPA
RRQGQLVLDAGAAQVEFDAEHLRRVLVNLLDNALRYKGPEPDSLCLATRATPGGKAGVQV
WSDGAPLDKSVERHLFEPFFSSESRSSGLGLYICRELCQRHGAAIGHQRTTRSLARGEVA
GNAFTVTFRSLSRPADSASLFDTIVV
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgccctccaagctggcagccgccgcctctcccctgccctttcatcgcctgtggaatgcc
ttcctcacagcgcgcgtgatggtggcgctggcgctgctgctgctgcagttgctgggcatt
gcactcaaccaggccggcgaaccgctgctgttcagcatctgcctgggctacctggtggcc
acggtggcgctgcgggtgtggggacacggcgcggtgcccgacccgcgccccggcatccag
tggttgccgtccatcgggctggatctgttgctggtcagcgtgctgcaggcgctgcagcag
tcgggcggcttgaatttcacgccgttgttcgggcttccggtcctgatggcaggcgtgctg
ggatccttgacactggctctggcaaccacggccggcgccacgctgctgctgctggcctgg
gcctggtggctgggcacatacggcggcgccggagacggcacgcagcgctacctgcaggcg
gcattaacaggcaccggctacttcatcgtcgcctatctggtgcacctgctggccgccaag
ctcaccagcgagcagcagatggcccggcgcagccagatggatgcgcgcacccaccgcgcg
gtcagtgccctggtgatgcagcacgtggccgatggcgtgctggtgctggacctgcatggc
caggtccgcctggccaaccctgcggcgttgctgatgctcggccacaagatctccggagat
tcctccctgacgctcacgcacacggcggccttcaaacccctcatggatctggcgtgcgcc
actttccagatggagcgtccccagcatgccgatgtcaacgtcctgcacgatggccagatc
cccatggccctgcgcgtgcgcgcatggctcacccacacgcaggacgccccggacgactct
ccgggggagccgctgtgcgtgatgttcctgcacgacctgcgcgaaatggaagcgcgcctg
cgcaccgagaagctggccgccatggggcgcatgtcggccgccgtggcacatgagatccgc
aacccgctggcagcgatcgtgcaggccaacgaactgctggacgaagacctggacgacccc
acacagaagcgcctgacacacatggtgcgccaaaacgccgaccggctggtgcgcatcacg
gaagacgtactggacattgcgcgcgtgcagcaccagatcaaccaggccagctcctccacc
gtggcactggatgccaccgtgcagcaggtgtggaacgactggacggcgcaggaccccgca
cgccggcaggggcaattggtactggacgcgggcgcggcgcaggtggagttcgacgccgag
cacctgcggcgcgtgctggtgaacctgctggacaacgcattgcgctacaaagggcccgaa
cccgactcgctgtgcctcgcgacgcgcgccacccccggcgggaaggccggcgtgcaggtg
tggagcgatggcgcaccgctggacaaatcggtggagcggcatctgttcgagcctttcttc
tcatccgaaagccgctccagcgggctgggcttgtacatctgccgcgagctgtgccagcgc
cacggggcggcgatcggccatcagcgcaccacacgcagcctggcgcgcggcgaggtggcg
ggaaacgccttcactgtgacctttcgcagcctttcgcgccctgcggacagcgcatcactg
tttgacacaatcgtggtctga

DBGET integrated database retrieval system