KEGG   Acidovorax ebreus: Dtpsy_2978Help
Entry
Dtpsy_2978        CDS       T00853                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dia  Acidovorax ebreus
Pathway
dia00473  D-Alanine metabolism
dia00550  Peptidoglycan biosynthesis
dia01100  Metabolic pathways
dia01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dtpsy_2978
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dtpsy_2978
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Dtpsy_2978
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dia01011]
    Dtpsy_2978
Enzymes [BR:dia01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dtpsy_2978
Peptidoglycan biosynthesis and degradation proteins [BR:dia01011]
 Precursor biosynthesis
  Amino acid ligase
   Dtpsy_2978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST GARS_A TTL ATP-grasp_5 ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACM34411
UniProt: B9MFR0
LinkDB All DBs
Position
complement(3170795..3171793)
Genome map
AA seq 332 aa AA seqDB search
MSQNDPKIDVKALGKVAVLMGGTSAEREVSLMSGGGVLQALRSRGVDAHAFDPAHSDLSE
LKAHGYSRCFIALHGRHGEDGTVQGALELLGIPYTGPGVMASSIAMDKIMTKRIWRADGL
PTPDWRLVSSSAETAQAFQELGAPMIVKPSREGSTIGLTKVTSLGQCEQAYRLAAQHDPE
VLCEQFIDGDETTCPILGQGAEARALPVIRIEAPQGNYDYQNKYFTDVTQYHCPSGLPEA
EEREIQRIVVQAYRTLGCRGWARADIMIRASDRKPFLLEINTSPGMTGHSLVPMSANASG
ISYPDLCLRILASASLDALQGRAGAAGGREPV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaacgaccccaagattgatgtgaaggcgctgggcaaagtggccgtgctcatg
gggggcacgtcggccgagcgtgaggtgtcgctgatgtcgggcggcggcgtgctgcaggcg
ctgcgctcgcgtggcgtggacgcgcatgcgttcgaccccgcgcacagtgatctgtcggag
ctcaaggcccacggctacagccgctgcttcatcgcgctgcacggccgccatggcgaggac
ggtacggtgcagggcgcgctggagctgctgggcattccgtacaccggtcccggcgtgatg
gcgtccagcatcgccatggacaagatcatgaccaagcgcatctggcgcgcggacggcctg
cccacgccagactggcgcctggtgtccagcagtgcggagacggcccaggccttccaggag
ctgggcgcgccgatgatcgtcaagccctcgcgcgagggctccaccatcggcctgaccaag
gtcacttcgctggggcagtgcgaacaggcgtatcggctggccgcgcagcatgaccccgag
gtgctgtgcgagcagttcatcgatggtgacgagaccacctgtcccatactgggccaaggc
gccgaggcgcgcgcgctgccggtgatccgcatcgaggcgccgcaaggcaactacgactac
cagaacaaatacttcaccgacgtcacgcagtaccactgcccgagcggcctgcccgaggcc
gaggagcgcgagatccagcgcatcgtcgtgcaggcttaccgtacgctgggttgccgcggc
tgggcgcgcgccgacatcatgatccgcgcgagcgatcgcaagcccttcctgctggaaatc
aacacctcgcctggcatgaccggccactcgctggtgccgatgtcggccaatgccagcggc
atcagctaccccgacctgtgcctgcgcatcctggcgagcgcgtcgctggacgcgctgcag
ggccgggccggtgcggcaggaggacgggagccggtatga

DBGET integrated database retrieval system