KEGG   Dickeya sp. NCPPB 569: Dpoa569_001553
Entry
Dpoa569_001553    CDS       T06188                                 

Gene name
rlmKL
Definition
(GenBank) bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
dic  Dickeya sp. NCPPB 569
Brite
KEGG Orthology (KO) [BR:dic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dic03009]
    Dpoa569_001553 (rlmKL)
Enzymes [BR:dic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     Dpoa569_001553 (rlmKL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     Dpoa569_001553 (rlmKL)
Ribosome biogenesis [BR:dic03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Dpoa569_001553 (rlmKL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 MTS Methyltransf_11 Methyltransf_15 N6_Mtase Methyltransf_24 TRM
Other DBs
NCBI-ProteinID: QDX29762
UniProt: A0A5B8I3U8
LinkDB
Position
1697266..1699389
AA seq 707 aa
MNSLFASTARGLEELLKSELEALGAQHCTVVQGGVHFQGDDRLLYQSLMWSRLASRILLP
LNEFNVYSDLDLYLGVQAVDWSAVFDVNHTFAVHFTGTNDEIRNSQYGALKVKDAIVDSF
SRKTGQRPDVARQQPDIRINVFLQREKASVALDLSGESLHLRGYREMAGQAPLKENLAAA
IVLRSGWETGTPMVDPMCGSGTLLIEAAMMAADRAPGLHRQHWGFLAWQKHNPTLWKSVI
TEAQERARAGLQATTSRFFGSDIDRRMVEIASSNARRAGVSSLIRFEAHDATQLKNPLPQ
GPTGTVVSNPPYGERLESEPALIALHNLLGRKMKSEFGGWTLSLFSASPELLSCLQLRAD
RQFKAKNGPLECVQKNYQLAENEAGAQHSATFAEDFANRLRKNLRKLEKWAQQQGIECYR
LYDADLPEYNVAVDRYGERVVIQEYAPPKSIDAQKARQRLFDVINATLSVLALPASHLIL
KTRERQKGKNQYEKLAEKGEFLQVSEFNAKLWVNLTDYLDTGLFLDHRIARRMLGEMSNG
KDFLNLFAYTGSASVHAGLGGARSTTTVDMSRTYLEWAEKNLRLNGLTGRQHRLIHADCL
AWMRETREQFDVIFIDPPTFSNSKRMDESFDVQRDHLMLMTQLKRLLRPRGTILFSNNKR
GFQMDQAGLAALGLEAKEITAQTLSQDFARNRQIHNCWLLKHAGEEK
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgaactctctgtttgccagcacggcgcgtggtctggaagaattgttaaaaagcgaactt
gaagcgctgggcgcgcagcactgcacggtggtgcagggcggagtgcactttcagggagat
gatcggctgctgtaccagagcctgatgtggagccgactggcatcacgcatcctgctgccg
ctcaacgagtttaacgtttatagcgatctggatctgtacctgggcgtgcaggcggtggac
tggagcgcggtgtttgacgtcaaccacacctttgcggtgcattttaccggcaccaacgac
gagattcgcaacagccagtacggtgcgctcaaagtcaaagacgccattgtagacagcttc
agccgtaaaaccggccagcgcccggacgttgcccgtcagcagcctgatatccgtattaat
gtatttttgcaacgcgagaaggccagcgtcgcgctggatttaagcggcgagagcctgcat
ctgcgcggttatcgtgagatggccgggcaggcgccgctcaaagagaatctggcggcggcg
atagtcctgcggtccggttgggaaaccggtacgccgatggtggacccgatgtgtggctcc
ggcacgctgctgattgaggcggcgatgatggcggcggatcgcgcgcccggtttgcatcgt
cagcactggggatttctggcctggcagaaacacaatccgacgctgtggaaaagcgtcatt
accgaggcacaggagcgggcacgggcggggttgcaggcgaccacttcccgtttcttcggt
tctgatatcgaccgccgtatggtggagatcgccagcagcaacgcccgccgtgccggggtc
agttccctgattcggtttgaagcccatgacgccacacagttgaaaaatccgctgccgcag
ggaccgacaggcacggtggtcagcaacccgccttatggtgagcgactggaaagcgaaccg
gcgctgattgcattacacaatctgcttggtcgcaaaatgaaaagcgagtttggcggttgg
acgctgtcgctgtttagcgcctcgccggaactgctcagttgtttgcaactgcgtgctgat
cgccagttcaaggccaaaaacggcccactggagtgcgtgcagaagaattatcaactggcg
gaaaacgaagcgggcgcacagcactcggcaacattcgccgaagatttcgccaaccgtctg
cgcaaaaatctgcgcaagctggagaaatgggcgcagcagcaggggattgagtgctatcgc
ctgtatgacgccgatctgccggaatacaacgtggcggtggaccgctacggcgagcgggta
gtgattcaggagtacgcgccgccaaaaagcattgatgcccagaaggctcgccagcggttg
tttgatgtgatcaacgccaccctgagcgtgttggcgttgcccgccagtcatctgatattg
aaaacccgtgagcgtcagaaaggcaaaaaccagtacgaaaagctggccgagaaaggggag
ttcctgcaggtatcggagttcaacgccaaactatgggttaacctgaccgactatctcgac
accggactgtttctcgatcaccgtattgcccgccgtatgctgggggagatgagtaacggc
aaggatttcctcaacctgttcgcttataccggcagcgccagtgtgcacgccgggctgggc
ggcgcacgctccactaccacggtggatatgtcgcgcacctatctggaatgggcggagaag
aacctgcgtcttaacggcctgaccggtcgtcagcaccggctgatccatgctgattgtctg
gcgtggatgcgtgaaacccgcgaacagtttgatgtgatttttatcgatccgccgacgttc
tccaactccaaacggatggatgagtcgttcgatgtgcagcgtgatcacctgatgctgatg
actcagcttaaacgactgctgcgccctcgcggcactatcctgttttctaacaacaaacgc
ggattccagatggatcaggctgggcttgccgcactgggactggaggcgaaggagattacc
gcacaaaccttgtcgcaggatttcgcccgtaatcgtcagattcacaactgctggctgttg
aaacacgccggcgaggaaaaataa

DBGET integrated database retrieval system