KEGG   Dickeya sp. NCPPB 569: Dpoa569_002901
Entry
Dpoa569_002901    CDS       T06188                                 

Definition
(GenBank) lytic transglycosylase domain-containing protein
Organism
dic  Dickeya sp. NCPPB 569
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: QDX30970
UniProt: A0A5B8IGK3
LinkDB
Position
complement(3201598..3202221)
AA seq 207 aa
MANCGVLITLLFSLMMPLTSSATDFVLDIPWAYQQIAQDERVPVESLYSLALAESSKKLA
GGRVRPWPWTINVAGTGYRYETREKAMAALLSFIRVYPLKRIDVGIAQVNLGWNGHLFPS
LHDAFDPYLNLRVAARLLRACYDSSPGSWLRAAGCYHHPAGGQAARVYMAIVRSKLDAMG
DTRQKTKPLSVASATSLSQLTWVEPGK
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcaaattgcggcgttttaatcactttgttgttttctctgatgatgccgttgacatca
tcggcaactgactttgtcctggatattccctgggcttaccaacagattgcgcaggacgag
cgggtcccggttgaatctctttactcgttggcgttggctgaaagctccaaaaagctggca
ggggggcgggtacgtccgtggccatggacgattaacgttgcggggacgggatatcgctat
gagacccgtgagaaagcgatggcggcgctgttgtcatttatccgggtgtatcccctcaaa
cgcattgatgtcggtattgcccaggtcaatctcggctggaacggtcatcttttcccatcg
ttacacgatgcgtttgatccctatctcaacctgcgtgtggcggcacgactgctgcgcgcc
tgttacgactccagtcccggaagttggctccgggctgcagggtgttatcaccatcccgcc
ggcggacaggcggcccgggtgtatatggccatcgttcgcagcaagctggatgcgatgggg
gatacccgtcagaaaacgaaacccctttctgtggcgtctgccacgtctttgtcccagttg
acctgggtggagcccggtaaatga

DBGET integrated database retrieval system