KEGG   Dickeya sp. NCPPB 569: Dpoa569_003451Help
Entry
Dpoa569_003451    CDS       T06188                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dic  Dickeya sp. NCPPB 569
Brite
KEGG Orthology (KO) [BR:dic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dpoa569_003451 (ahpF)
Enzymes [BR:dic01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Dpoa569_003451 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 Glutaredoxin DAO FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C FMO-like DSBA
Motif
Other DBs
NCBI-ProteinID: QDX31446
UniProt: A0A5B8HT13
LinkDB All DBs
Position
complement(3797268..3798830)
Genome map
AA seq 520 aa AA seqDB search
MLDNNVQLQLKTYLEKLTKPVELVATLDDSAKSAEVRELLIEVAGLSDKVSFFENNDLPV
RKPSFLVTNPGAATGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAKELLDQIHSLDGTFH
FETYYSLTCHNCPDVVQALNLMSILNPNITHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FSQGRMSLAEIVGKIDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQRLISASEPG
QPHQIETASGAVLKSRSIIIATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQSKLRSLPNVDVIVNAQTTEVLGD
GQKVTGLQYKDRVTDSVHKLALEGIFVQIGLLPNTAWLEGTVERNRIGEIEIDVRCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDHLIRTQG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataacgtgcagctccagctgaaaacctatctggaaaaattaaccaaaccg
gttgagttagtggcgacgctggatgactcagcgaaatccgctgaagttcgggaactactc
attgaggttgccgggttgtccgacaaagtcagtttctttgaaaataatgacctgcctgtg
cgtaagccttcgttcctggtaaccaatccgggggcggccaccgggcctcgcttcgctggt
gcaccgatgggacacgaatttacctcgctggtgctggcgttgctgcaaactggcggtcac
ccgtcgaaagaagcgaaggaattgctggatcaaatccacagcctggacggcacgttccac
tttgaaacctattattcgctgacctgccacaattgtccggacgtggtgcaggcgctgaat
ttaatgtccatcctgaacccgaacattacccatactgccattgatggcggtgtgtttcag
gatgagatcaaggatcgcaatatcatgggcgtccccacggtatttctgaacggcgagcat
ttcagccaggggcgcatgagtctggctgagatcgtcggtaaaattgacaccggcgccaac
gcccgtgtggtcgataagctcaacagccgtccggtgtatgacgtgctgatcgtcggcagc
ggcccggcgggtgcggcggcggctgtatacgcggctcgtaaaggtattcgcaccggcctg
atgggcgagcgctttggtggtcagattctggataccgtcgatatcgaaaactacatttcg
gtgccgaagaccgaaggcgccaaactggcgaccgcgctgaaaacccatgtagatgactac
gatgttgatgttatcgatttacagagcgcgcaaagattgatttcggcttctgaaccgggt
cagccgcaccagatcgaaaccgcctccggcgccgtgctgaaatcccgtagcatcatcatt
gctaccggtgcgcgctggcgcaacatgaacgtgccgggtgaagagcagtaccgtacccgt
ggcgtgacctattgcccgcattgcgatggtccgctgtttaaaggcaagcatgtggcggtg
atcggcggcggtaactccggcgtggaggcggctatcgacctggcgggcgtggtgaaacac
gtcaccctgctggagttcgcgccagaactgaaagcggattccgtgctgcagagcaaactg
cgcagcctgccgaacgtggacgtgattgtgaatgcccagaccacggaagtgttgggtgat
ggacagaaggtcaccggcctgcagtataaggatcgcgtcactgacagcgttcataagctg
gcgctggaagggatttttgtacaaatcggcctgctgccgaatacggcctggctggaagga
acggttgagcgcaatcgcatcggtgaaattgagatcgatgtccgttgtgaaaccagcgtg
aaaggtgtgtttgcggcgggggactgcactaccgtaccttacaagcagattatcatcgcc
actggcgaaggggccaaagcctctctgagcgcgtttgatcatctgatcagaacccagggg
taa

DBGET integrated database retrieval system