KEGG   Diaphorobacter sp. HDW4A: G7047_15260Help
Entry
G7047_15260       CDS       T06499                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dih  Diaphorobacter sp. HDW4A
Brite
KEGG Orthology (KO) [BR:dih00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G7047_15260 (ahpF)
Enzymes [BR:dih01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G7047_15260 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA HI0933_like FAD_binding_2 AlaDh_PNT_C Glutaredoxin Thi4 FAD_binding_3 DAO NAD_binding_8 K_oxygenase FMO-like DSBA ABC_transp_aux
Motif
Other DBs
NCBI-ProteinID: QIL81107
LinkDB All DBs
Position
complement(3347755..3349314)
Genome map
AA seq 519 aa AA seqDB search
MLDTTLQTQLKAYLERLQRPVELVATLDDSATAKEVRELLNEIKALSDKITVVEKNDLAN
TRKPSFLITNPGIDTGVRFAGVPLGHEFTSLVLALLQVGGHPSKEAADLLEQVKNLKGEF
HFETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGSVFQEEIKDRQIMGVPTVFLNGK
NFGQGRMELAEIVAKVDSGAHARVAAKLNAMDPFDVLVVGGGPAGAAAAVYAARKGIRTG
VAAERFGGQVLDTVDIENYISVSKTEGPKFAIALEQHVADYDVEVMNLQRAKALKPAATE
GGQVEIELENGATLKSKTVILSTGARWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVA
VIGGGNSGIEAAIDLAGIVSHVTVLEFASELKADGVLQKKLASLPNVTVILNAQTTEVNG
DGNKVTGITYKDRTNDEIRTVELEGIFVQIGLLPNTDWLKGTVDLTKFGEIIIDAKGHTN
VPGVFAAGDCTNVPYKQIIIAAGAGATAALSAFDHLIRH
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccactctccaaacccaattgaaagcgtatctggaacgcctgcagcgtccg
gtggagctggtggctacgctggacgatagcgccaccgccaaggaagtgcgcgaacttctc
aacgagatcaaagcgctttcagacaagatcactgtggtcgaaaagaatgacttggccaac
acgcgcaagccgtctttcctgatcaccaaccccggcatcgatactggcgtgcgtttcgcc
ggtgtgccgctgggtcatgaattcacatcgctggttctggcgttgctgcaagtgggtggc
catccatccaaggaagcggccgatctgctggaacaagtgaagaacctcaaaggcgaattc
cacttcgagacctactactcgctctcctgccacaactgcccggacgtggtgcaggcgctc
aacctgatgagcgtgctgaacccacgcatcacgcacaccgccattgatggttcggtgttc
caggaagagatcaaggaccgccagatcatgggtgttcccacggtgtttctgaacggcaag
aacttcggtcagggccgcatggagctggccgagattgtcgccaaggtcgacagcggcgcc
catgcccgcgtagcagccaagctcaacgccatggacccgttcgacgtgctcgtcgtcggc
gggggccctgctggagcagccgctgccgtgtatgcggcgcgcaagggcattcgcaccggt
gtggcggccgagcgtttcggtggccaggtgctggacaccgtggacatcgagaactacatc
tcggtcagcaagaccgaaggccccaagtttgctattgcgctggagcaacacgtggcggac
tacgacgttgaagtgatgaacctgcaacgtgccaaggccctgaagcctgccgccaccgaa
ggtggacaggtcgaaattgaactcgagaacggtgccacgctcaagagcaagaccgtgatc
ctctcgaccggtgcacgctggagaaacatgaatgtgcccggcgaagagcaataccgcacc
aagggcgtgacctactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtcgcg
gtgatcggcggcggcaactcgggtatcgaggctgcgatcgatctggccggtattgtgtcc
cacgtgacggtgctcgagttcgcgtctgaactcaaggccgacggcgtgctgcagaagaag
ctcgccagcctgccgaacgtgaccgtgatcctcaacgcccagacaaccgaggtgaatggt
gacggcaacaaggtcaccggtatcacctacaaggaccgcacgaacgacgagatccgcacc
gtcgagctcgaaggcatcttcgtgcagatcggcttgctgcccaataccgactggctcaag
ggcacggtcgatctcaccaagttcggcgagatcatcatcgacgccaagggccacaccaat
gtaccgggcgtgttcgccgcgggtgactgcacgaacgtgccctacaagcagatcatcatc
gctgcgggtgccggtgccacggctgcgctgtcggcgttcgatcatctgatccgtcattga

DBGET integrated database retrieval system