KEGG   Diaphorobacter sp. HDW4A: G7047_16520
Entry
G7047_16520       CDS       T06499                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
dih  Diaphorobacter sp. HDW4A
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Pkinase_fungal Pox_ser-thr_kin Kdo
Other DBs
NCBI-ProteinID: QIL81336
LinkDB
Position
3624346..3625353
AA seq 335 aa
MSKIKPSPLPPDTVIGGYRIVRRVAAGGFGVVYQAISADDQTVAVKEYLPSSLASRAQGE
LAPVVSPEKLSLYRLGLKSFFEEGRSLAQISHPSVVSVLNFFRENETVYMVMNYLEGATL
QDFIITARDQKAQKIFRESTIRSLFDEVLRGLRIVHQHKMLHLDIKPANIFITDDDRAVM
IDFGAAREVLSKEGNFIRPMYTPGFAAPEMYRRDAQMGPWTDIYAIGACIYACMHGYPPT
EATQRSDKDRLTAALAKMRGLYSDNLIEVVEWCMALDPLSRPQSVFALQKELSREGERRY
TKLTVAEKMRLQIDTLVADTRNNVLKVGSGPGKIQ
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtcgaaaatcaagccttccccactccccccggataccgtcatcggcggatatcgaatc
gtacgccgcgtagctgctggcggcttcggtgttgtctatcaagcgatcagcgcggacgac
cagacagtcgccgtcaaggaataccttccttcgtccctcgcctcgcgtgcacagggtgag
ctcgctccggtcgtttcccccgaaaaactgtcgctttatcgcctcggcctcaagagcttt
ttcgaagaaggtcgctcgttggcccagatatcgcacccctccgtggtgagcgtgctgaat
ttcttccgcgagaacgagaccgtctacatggtgatgaactacctggaaggcgccacgctg
caggatttcatcatcactgcgcgcgaccaaaaggcgcagaagatcttccgcgaatccacc
atccgctcgctgttcgacgaggtgctgcgcggcctgcgcatcgtgcaccagcacaagatg
ctgcacctcgacatcaagcccgccaacatcttcatcaccgacgatgaccgcgccgtgatg
atcgatttcggcgccgcacgcgaggtgctatccaaggaaggcaacttcatccgtccgatg
tacacgcctggcttcgccgcacccgagatgtaccgccgcgacgcccagatgggcccgtgg
accgacatctacgccatcggcgcctgcatctacgcctgcatgcacggctacccgcccacc
gaagcgacgcagcgctccgacaaggaccgcctcaccgccgcgctcgccaagatgcgcggt
ctctactccgataacctgatcgaggtcgtcgagtggtgtatggcgctggatccgctgtcg
cgccctcaatccgtcttcgcgctgcaaaaagaattgagccgcgaaggcgagcgccgctat
accaaactcacagtcgcagagaaaatgcgcctgcaaatcgacacactcgtggctgataca
cgcaacaacgtcctcaaagtaggcagcggcccagggaaaatccaatga

DBGET integrated database retrieval system