KEGG   Desulfurispirillum indicum: Selin_0576Help
Entry
Selin_0576        CDS       T01383                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
din  Desulfurispirillum indicum
Pathway
din00500  Starch and sucrose metabolism
din01100  Metabolic pathways
din01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:din00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Selin_0576
Enzymes [BR:din01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Selin_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ADU65324
UniProt: E6W0Z2
LinkDB All DBs
Position
complement(612140..614704)
Genome map
AA seq 854 aa AA seqDB search
MKNFSYYTVVPKLPEPLKPLQEISQNMWWSWQTDAIELFYRIDQDLWNNPSIEHNPIRLI
GALSWERLEELAEDEGFLNHMNSVYREFQHYMTLETWYSRLSRDWQNFTIAYFSLEYGIH
ESLPIYSGGLGILSGDHLKSASELGIPLVGVGLLYRHGYFRQSLNADGWQHERYPENDFH
NMPISLVRDKSGSPIKPYIDYPFGRVFFQIWQVAVGRITLYLLDACLDENAPEGREITKQ
LYGGDEEMRLKQEVLLGIGGIRALKSIGINPTVCHMNEGHSGFMPLERIRYLMHEQSLGF
DAAFEAVYATNIFTTHTPVPAGNDRFTAEQVMKYLGKYIKELGIDAESFLGLGRENPDNK
SELFCMTVIAIRMAGFKNGVSQLHGSVSRQMWKNIWPTVPEQETPIEHITNGVHVLSWLS
RDMKDLLERYLGERWVDDPYDKEIWKKVRSIPDPELWHAREGLRRRLITFVRKRLKESLQ
RRGASKSEMALADEVLDPKALTIGFARRFATYKRGNLLFNDLDRLRSILADESRPVQFIF
AGKAHPRDEGGKRIIKEIIHTVGLPEFRHKIVFLEDYDISLGRKLVQGVDLWLNNPRRPL
EACGTSGMKVTPNAGLNMSILDGWWEEGYDPELGWSIGGRETYDDLSFQDEVESNSIYSL
LENEVLPAFYTRSADGIPRKWLQMVKEAMVNLLPVFNTNNMVENYTTRYYLNASINWNQF
EFENFAHARHVATWNSRVRAHWSSVSVRSVTIGQGTELGVGELAPVVAEVNLGNLTPQDV
IVEAYYGRMEHTGRSIQQGQTQVLNSVEHIDGNLYRFHGMLPCPNSGRFACTLRVINNSP
LDIRRLDITPLIWW
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttttcttattacaccgttgtgccaaaactgcctgaacccctcaaacccttg
caggaaatatcccagaacatgtggtggagctggcagaccgatgccatagagctcttctac
cgcatagatcaggatctctggaacaacccctccattgagcacaaccccatccgcctcatt
ggcgccctgagctgggagcggctggaagaactggccgaggatgagggtttcctcaaccac
atgaacagcgtctaccgcgaattccagcactatatgaccctggagacctggtactcacgc
ctgtcgcgggactggcagaattttaccatcgcctacttctccctggagtatggcatccat
gaatccctgcccatttactctggcggcctgggcatcctctccggcgaccacctgaagtca
gccagtgaactggggatccccctggtgggagtggggctgctctatcgccacggctatttc
cggcaatccctcaacgccgacggatggcagcacgagcgctatccggaaaatgactttcac
aacatgcccatcagcctggtacgcgacaaaagcgggtcccccatcaaaccctacatcgac
tatccctttggacgcgtcttttttcagatctggcaggtcgccgtcggccgcatcaccctc
tacctcctggatgcctgcctggatgaaaacgccccggaagggcgtgagatcaccaaacag
ctctatggtggcgacgaagagatgcgtcttaagcaggaagtcctgctgggcatcgggggt
attcgtgccctgaaatccataggcatcaatcccaccgtctgccatatgaacgaaggccac
agcggcttcatgcccctggaacgcatccgctacctgatgcacgaacagagccttggcttt
gacgccgcttttgaagccgtatatgccaccaatatcttcaccacccacacaccggttcca
gccggcaatgatcgcttcactgccgagcaggtcatgaagtatcttgggaaatacatcaag
gagctcggcatagacgcagaaagcttcctggggcttggacgggagaaccccgacaacaag
agcgaactgttctgcatgactgtgatagccatccgcatggccggcttcaaaaacggcgtc
agtcagctgcacggcagcgtctcacgccagatgtggaaaaacatctggcccaccgtgccc
gaacaggaaacccccatagaacacatcaccaacggtgtacacgtgctctcctggctctcc
cgcgatatgaaagacctgctggagcgctacttgggcgaacgctgggtggatgacccctat
gacaaggaaatctggaaaaaagtccgcagcattccggatcctgaactgtggcacgccagg
gaggggctgcgccgtcgcctgataacctttgtgcgcaagcgactcaaggaatccctgcag
cgccgcggtgcctcaaaaagcgaaatggccctggccgatgaggtgctcgaccctaaagcc
ctgactatcggttttgcccgccgcttcgccacctacaagcgtggcaacctgctcttcaat
gacctggatcggctgcgcagcatactggctgacgaaagccggccagtgcagtttatcttt
gccggcaaggcccacccccgcgacgagggcggcaagcgcatcatcaaggagataatccac
accgtcggactgccggaattccgccataaaatcgtctttctggaagactatgatatcagc
cttggccgcaagctggttcagggtgttgacctgtggctcaataatccccgtcgccccctt
gaagcctgtggcacctcgggcatgaaggtgacacccaacgccggactcaacatgagtatt
ctcgatggatggtgggaagaggggtacgacccggagctgggctggagtatcggcggacgc
gaaacctacgacgacctgagttttcaggacgaggtggaaagcaattccatctattcactg
ctggaaaacgaagtgctgccagccttctacacccgctccgccgatggtatcccgcgcaag
tggctccagatggtcaaagaggccatggtcaatctgttgccggtattcaacaccaataac
atggtggaaaactacaccaccagatattacctgaacgccagtattaactggaatcagttt
gagtttgaaaattttgcccacgcccgccacgtggccacatggaacagccgtgtcagagct
cactggagcagcgtctctgtgcgcagcgtcaccatcggccagggcactgaactgggagtt
ggagaactggcaccggtggtggccgaagtcaacctgggcaatctgactccccaggatgtc
attgtcgaagcctactacggcaggatggagcacaccggtcgcagcatccagcaggggcag
acgcaggtgctcaacagtgtcgaacacatagatggcaacctctatcgcttccatggcatg
ctgccctgccccaacagcggacgcttcgcctgcacactgcgcgtcatcaataactcgccg
ctggatatccgacgcctggatatcacacccctgatctggtggtaa

DBGET integrated database retrieval system