KEGG   Desulfurispirillum indicum: Selin_0721Help
Entry
Selin_0721        CDS       T01383                                 

Definition
(GenBank) chorismate mutase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
din  Desulfurispirillum indicum
Pathway
din00400  Phenylalanine, tyrosine and tryptophan biosynthesis
din01100  Metabolic pathways
din01110  Biosynthesis of secondary metabolites
din01130  Biosynthesis of antibiotics
din01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:din00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Selin_0721
Enzymes [BR:din01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Selin_0721
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     Selin_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: ADU65465
UniProt: E6W1T3
LinkDB All DBs
Position
764320..765414
Genome map
AA seq 364 aa AA seqDB search
MTNGNRLEELRDSIDAIDDKLLELLNSRAELAVQVGKYKSGNPSEFYVPSREKQIYTRLL
RENPGPIPDEAVRAIFREIISACLNLEQPLTIAFLGPEATFTHIASMEHFGQSARYLASP
SIRDVFSEVDRGRAHYGVAPIENSTEGVVNYTLDCLVETDLSICAEIELGITHHLMSTSG
KMENVKRVYSHPHAIAQCRQWLELNLPDVELVDITSTARAAEIASDNDDAAAICSELAGK
LYSLVPVMRKIEDKTNNFTRFIVVGKTRTKRSGNDKTSVVFGLSHAVGSLYHALEIISKF
RINMTKIESRPSKIKAWEYLFHVDLEGHREDENVAAALKMLEERSLFMKILGSYPKSIQS
AKGE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaatggtaatagattagaggagttgcgtgactccatagatgcgattgacgataag
ctgttagagctgcttaacagtcgggctgagcttgccgtgcaggtgggcaagtacaagtcg
ggcaatccttcagaattctacgttccctcccgtgaaaagcagatttatacccgcctgttg
cgggaaaaccccggtcccattcccgatgaggctgtgcgggcaattttccgcgagatcatc
tcagcgtgtctcaaccttgagcagccgcttaccatcgcctttcttggtcctgaagcgact
tttacccatattgccagcatggaacactttggtcagagcgcccgttacctggcctctccc
agtatccgggatgtcttctctgaggttgatcgcgggcgggcgcactatggcgtggcgccc
attgagaactcgactgaaggggtcgtgaactatacccttgactgcctggtggagaccgac
ctgtctatctgtgccgagatcgagctggggatcacccatcacctgatgagcaccagtggc
aaaatggaaaacgtcaagcgggtctattcgcacccccatgccattgcccagtgtcggcag
tggctggaactcaatcttcccgacgtggagctggtggatattaccagcacggcgcgggcg
gcagagattgccagtgataatgatgacgcggcagcgatctgctctgagctggccggtaag
ctttattctctggtgccggtaatgcggaaaattgaagacaagaccaataatttcacgcgc
tttatcgtggtggggaaaacgcgcaccaagcgaagtggcaacgataagaccagtgtggtg
tttgggttgagccatgccgtgggctccctgtaccacgccctggagatcatctcgaaattc
cgcatcaatatgaccaagattgagtcccgcccctccaaaatcaaagcctgggagtacctt
tttcacgtggaccttgaagggcaccgcgaggatgaaaatgtggcagccgcgctgaaaatg
ctggaagagcgcagtcttttcatgaaaattctgggatcctatcccaaaagtatacagtct
gcaaaaggtgaataa

DBGET integrated database retrieval system