KEGG   Desulfurispirillum indicum: Selin_1638Help
Entry
Selin_1638        CDS       T01383                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
din  Desulfurispirillum indicum
Brite
KEGG Orthology (KO) [BR:din00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Selin_1638
Enzymes [BR:din01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Selin_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_oxidored FAD_binding_2 Thi4 K_oxygenase NAD_binding_9 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADU66368
UniProt: E6W0F0
LinkDB All DBs
Position
1787064..1787996
Genome map
AA seq 310 aa AA seqDB search
MSGEKVYDVIIAGLGPAGESAAIYTARKNLSTLIVAYDSGGQLTKTFDVENYLGIPYSTG
WEMAMKFEEHVRKYSNVEIELMQEVVAIEDHGTTKKFITAEGREFQGRSAIIATGAKPKT
VGVKNEEKFNGKGLTYCTTCDGPLYRNKIVTIIGGGTSGVEAALEMVKIASKVQLIVRSQ
LRAEPILMDRLKEVSVDIYENTIPVEILGDEYVTGLRIRDRNSSVEQELTTDGIFVEIGR
APNADGLKNLLQTNDNGEIVISTYNETNIPGVFAAGDVTDVKFKQVIIAAGEGAKAAMKV
SEYLIKQGQK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagaaaaggtgtatgacgttattattgcaggacttggccccgcaggtgaaagt
gctgccatctatacggcccgcaagaatctttcaaccctgatcgtggcctatgattccggt
ggacagctcaccaagacctttgacgtggagaactacctgggcataccctactccaccggc
tgggaaatggccatgaagtttgaggagcatgtgcgcaaatactccaatgtggaaattgag
ctcatgcaggaggtcgtggccattgaggatcacggcacgaccaagaagttcatcacggca
gagggtcgcgagtttcaggggcgttcagccattatcgccactggcgccaaacccaagacc
gtcggggtcaagaatgaagaaaagttcaacggcaaagggctgacctactgtaccacctgc
gacggccccctctaccgcaacaagatcgtcaccattatcggtggcggcacttccggggtg
gaagcagccctggagatggtgaaaatcgcctcgaaagtccagcttatcgtgcgcagccag
ctcagggccgagcccattctcatggatcgcctcaaggaagtcagcgtggatatctacgaa
aacactatcccggtggagatccttggcgatgagtatgtgacgggtctgcgtatccgcgac
cgcaacagttccgtggaacaggaactgaccactgacggcatctttgtggaaatcggccgc
gcgcccaacgccgatggcctgaaaaatctcctgcagaccaatgacaacggtgagattgtc
atctccacctataacgaaaccaacattcccggtgtctttgccgccggcgatgttacggat
gtcaagttcaagcaggtgatcatcgctgctggcgaaggggccaaggcggccatgaaggtc
tccgagtacctcatcaagcagggtcagaaatag

DBGET integrated database retrieval system