KEGG   Dietzia sp. oral taxon 368: C3V38_08660Help
Entry
C3V38_08660       CDS       T05390                                 

Definition
(GenBank) cold-shock protein
  KO
K03704  cold shock protein
Organism
dit  Dietzia sp. oral taxon 368
Brite
KEGG Orthology (KO) [BR:dit00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    C3V38_08660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: AVM64447
UniProt: A0A2S0LVW4
LinkDB All DBs
Position
1845961..1846164
Genome map
AA seq 67 aa AA seqDB search
MAQGTVKWFNAEKGYGFIAPEDGSADLFVHYSSIEGTGFKSLEENQRVEFEVGEGQKGPQ
AQEVRAL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggcacagggcaccgtcaagtggttcaacgcggagaagggttacgggttcatcgctccc
gaggacggttccgccgacctcttcgtccactactcctccatcgagggcaccggcttcaag
tcgctcgaggagaaccagcgcgtcgagttcgaggtgggcgagggtcagaaggggccgcag
gcgcaggaggtccgcgccctctga

DBGET integrated database retrieval system