KEGG   Dietzia sp. oral taxon 368: C3V38_10390Help
Entry
C3V38_10390       CDS       T05390                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dit  Dietzia sp. oral taxon 368
Pathway
dit00020  Citrate cycle (TCA cycle)
dit00480  Glutathione metabolism
dit01100  Metabolic pathways
dit01110  Biosynthesis of secondary metabolites
dit01120  Microbial metabolism in diverse environments
dit01130  Biosynthesis of antibiotics
dit01200  Carbon metabolism
dit01210  2-Oxocarboxylic acid metabolism
dit01230  Biosynthesis of amino acids
Module
dit_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dit_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C3V38_10390
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C3V38_10390
Enzymes [BR:dit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C3V38_10390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AVM64721
UniProt: A0A2S0LWS8
LinkDB All DBs
Position
2224651..2225874
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWKFIKDELIHPYLDVNLEYYDLGIYSRDATDDQITVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKRMYRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIVGRHAFGDQYRATDFKAPGAGKVTITFTPADGSEPIEHEVVDLPEEGGVVM
GMYNFNKSIEDFARASFNYGLDRGYPVYLSTKNTILKAYDGAFKDIFQDVFDREFKEKFE
EAGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHFRRHQQGEPTSTNPIASIFAWTRGLEHRGKLDNTPEVIEFAHQLE
DVVINTVEGGQMTKDLAVLVGDDQGYLNTEDFLAALDENLKRTRAGS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagatcaaggtcgaggggacggtcgtcgaactcgacggcgacgagatgacgcgc
atcatctggaagttcatcaaagacgaactgatccatccctacctggacgtgaacctcgag
tactacgacctcgggatctacagtcgtgacgccaccgacgaccagatcaccgtcgacgcg
gccaacgcgatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcacgcccgacgag
gcccgcgtggaggagttcgggctcaagcgcatgtaccgctcgccgaacggcacgatccgc
aacatcctcggcggtaccatcttccgcgccccgatcatcatctccaacgtcccccgtctc
gtgccgggctggaccaaaccgatcatcgtcggccgtcacgccttcggggaccagtaccgc
gccaccgacttcaaggccccgggggcgggcaaggtcaccatcaccttcacgccggccgac
gggtccgagccgatcgagcacgaggtggtggacctgcccgaggagggcggcgtggtgatg
ggtatgtacaacttcaacaagtccatcgaggacttcgcgcgcgcctcgttcaactacggc
ctggaccgcggctacccggtgtacctgtccaccaagaacaccatcctcaaggcctacgac
ggcgccttcaaggacatcttccaggacgtcttcgaccgcgagttcaaggagaagttcgag
gaggcgggcctgacctacgagcaccggctcatcgacgacatggtggcgtcctcgctgaag
tgggagggcggctacgtatgggcgtgtaagaactacgacggcgacgttcagtccgacacc
gtggcacagggcttcggctcactcggcctgatgacctcggtcctgctcaccccggacggg
aaaacctgcgaggccgaggccgcccacggcaccgtgacccgccacttccgccggcatcaa
cagggcgagccgacctccaccaatccgatcgcctcgatcttcgcgtggacccgcggcctc
gagcaccgcggcaagctcgacaacacccccgaggtgatcgagttcgcccaccagctcgag
gacgtcgtgatcaacaccgtcgagggtggtcagatgaccaaggacctcgccgtgctcgtc
ggagacgaccaggggtacctcaataccgaggattttctcgccgcgctggacgagaaccta
aagcgcacccgcgccggctcctga

DBGET integrated database retrieval system