KEGG   Dietzia sp. JS16-p6b: CT688_04800Help
Entry
CT688_04800       CDS       T05397                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
diz  Dietzia sp. JS16-p6b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AVZ38900
UniProt: A0A2S0QDW0
LinkDB All DBs
Position
1061170..1062636
Genome map
AA seq 488 aa AA seqDB search
MTSSLDRDAFLIGTEWRSPATDGVIEVVSPHTEEIVARVPEGSVADIDAAVAAAREAFDS
GPWPRMSPQERIDVVARLSALYAAKLDDMATLISTEMGSPISFSTLAQAPAPWMQIEAFV
GIAREFPWEETRPGVLGGEVLVRHEPVGVVAAIPPWNVPQFTVLSKLIPALLTGCTIVIK
PAPETPLDTYLLGELLIEAGVPEGVVSIVAGGREVGEHLVRHPAVDKVAFTGSTAAGRKI
GAICGEQLKRCSLELGGKSAAIVLDDADLTSVVEGIKFLGVMNSGQACVAQTRILVSRER
HDEVAGALAEGIGSMVVGDPMDPDTQIGPMVAQRQQERVSSYIEIGQQEGAKLLTGGTGR
PDGLDSGWYVRPTVFAGVDNSMRIAQEEIFGPVLSVIAYDDVDDAVRIANDSDYGLAGTV
WTADREAGLGVARRVRTGTYGVNTYTMDFSAPFGGFKASGVGREFGPEGLAQYTEVKSVY
LDAPAVDG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctccctcgaccgcgacgcgttcctgatcggtaccgagtggcgctcacccgcg
accgacggcgtcatcgaggtggtcagcccccacaccgaggagatcgtcgcccgcgtcccg
gagggctcggtcgccgacatcgacgccgccgtggccgcggcgcgggaggcgttcgactcc
ggcccgtggccgcggatgagcccccaggagcggatcgacgtggtcgcccgtctctcggct
ctctacgccgcgaagctggacgacatggcgaccctgatctccaccgagatggggtcaccg
atctcgttcagtacgctcgcccaggctcctgcgccctggatgcagatcgaggcgttcgtc
ggcatcgcccgggagttcccgtgggaggagacccggccgggcgtgctcgggggcgaggtg
ctggtccgccacgagccggtgggcgtggtcgcggcgatcccgccgtggaacgtcccccag
ttcaccgtgttgtccaagctgatcccggcgctgctcaccggctgcacgatcgtgatcaag
cccgcccccgagaccccgctcgacacctacctgctgggcgagttgctcatcgaggccggg
gtgccggagggcgtggtgagcatcgtcgcgggcggccgcgaggtgggcgagcacctggtc
cgccaccccgcggtcgacaaggtggccttcacggggtccaccgcggcgggccggaagatc
ggggcgatctgtggcgagcagctcaagcgctgttcgctcgagctcggaggcaagtccgcg
gcgatcgtgctggacgatgccgacctcacgagcgtcgtcgagggaatcaagttcctgggc
gtgatgaactcgggtcaggcctgcgtggcgcagaccaggatcctggtgagccgcgagcgg
cacgacgaggtcgccggcgcactcgcggaggggatcgggtcgatggtcgtcggcgatccg
atggaccccgacacccagatcggcccgatggtggcgcagcggcagcaggaacgggtgtcg
tcgtacatcgagatcgggcagcaggagggggcgaagctgctcaccggtggcaccggccgc
ccggacggcctcgactcggggtggtacgtccgaccgaccgtgttcgcgggggtcgacaac
tccatgcggatcgcccaggaggagatcttcggtccggttctgtccgtgatcgcctacgac
gacgtggacgacgccgtccggatcgccaacgactccgactacggtctggcgggaaccgtg
tggaccgcggaccgggaggcggggctgggcgtcgcgcgtcgggtccgcaccggaacctac
ggggtcaacacgtacacgatggacttctcggccccgttcggcggcttcaaggcatcgggg
gtcggccgcgagttcggccccgagggcctggcgcagtacaccgaggtcaagtccgtctac
ctcgacgcgcccgcggtcgacggctga

DBGET integrated database retrieval system