KEGG   Dietzia sp. JS16-p6b: CT688_05655Help
Entry
CT688_05655       CDS       T05397                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
diz  Dietzia sp. JS16-p6b
Pathway
diz00250  Alanine, aspartate and glutamate metabolism
diz00410  beta-Alanine metabolism
diz00430  Taurine and hypotaurine metabolism
diz00650  Butanoate metabolism
diz01100  Metabolic pathways
diz01110  Biosynthesis of secondary metabolites
diz01120  Microbial metabolism in diverse environments
diz02024  Quorum sensing
Module
diz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:diz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CT688_05655
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CT688_05655
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CT688_05655
   00430 Taurine and hypotaurine metabolism
    CT688_05655
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CT688_05655
Enzymes [BR:diz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CT688_05655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AVZ39032
UniProt: A0A2S0QE70
LinkDB All DBs
Position
complement(1251792..1253249)
Genome map
AA seq 485 aa AA seqDB search
MAENSHVTARHTTARHAAARHTPARHTTDEGGESLTLDSVFVRPGEATELPRFTLPGDPS
LPETAYQIVHDEAMLDGNARLNLATFVSTWMDDEARRLYAETVDKNMIDKDEYPQTAAIE
ERCWRMIADLWNVPDVRESIGTSTIGSSEACMLGGLALKRRWQSARRAAGRSTESPNIVL
STAVQVCWEKFCNYFEVEPRWVPISAEHPMLDGHDLEEYVDENTIGVVAIMGVTYTGAYE
PVAEIARKLDQIQETTGLDVRIHVDGASGGMVAPFCQPDLEWDFRVGRVASINTSGHKYG
LVYPGVGWIVWRDRESLPESMIFHCSYLGGDMPTLALNFSRPGAQVLLQYYMFLRLGREG
YRRVQQASLDVAQFLASEIGALAPFELVSRGDTIPVIAWRLKEGYTETWTLYDLSDRLRM
KGWLVPAYPLADDLAHLTVLRIVVRVGLGRDLAAALIKDLAGEVMFLDQLDSPMPRKGPG
SHFHH
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaattcgcacgtcacagcccgtcacacgactgcacgccacgctgccgcacgt
cacacaccggcgcgtcacaccaccgacgagggcggcgagtcactgaccctcgattcggtc
ttcgtgcgtcccggcgaggccacggagctgccccgcttcacgctgccgggggacccctcg
cttcccgagacggcctatcagatcgtccacgacgaggcgatgctcgacggcaacgcgaga
ctcaacctcgcgacgttcgtctccacgtggatggacgacgaggcccggcgcctgtacgcc
gagaccgtcgacaagaacatgatcgacaaggacgagtacccccagaccgccgcgatcgag
gagcgctgctggaggatgatcgccgatctctggaacgtgcccgacgtccgggagtccatc
ggcacctccacgatcggctcgtccgaggcctgcatgctgggtgggctcgcgctcaagcga
cgctggcagtccgcgcggcgggcggccggtcggtccaccgagagccccaacatcgtcctg
tcgaccgccgtgcaggtctgctgggagaagttctgcaactacttcgaggtcgagccccgc
tgggtgcccatctcggcggagcacccgatgctcgacggacacgatctggaggagtacgtc
gacgagaacaccatcggggtggtggccatcatgggcgtcacctacaccggtgcctacgag
ccggtcgcggagatcgcccggaagctcgaccagatccaggagaccaccggtctcgacgtc
cgcatccacgtcgacggcgcgtcaggcggcatggtcgcgccgttctgccaacccgatctc
gagtgggatttccgtgtcgggcgcgtcgcgtccatcaacacctccggccacaagtacggg
ctcgtctacccgggcgtgggctggatcgtgtggcgcgacagggagtcactcccggagagc
atgatcttccactgcagctacctcggtggcgacatgcccaccctggcgctgaacttctcg
cgacccggggcgcaggtcctcctgcagtactacatgttcctccggctcgggcgggaaggt
taccgccgtgtccagcaggcgtctctggacgtcgcccagttcctggcctcggagatcgga
gcgctcgcccccttcgagttggtgagccgtggcgacacgattccggtgatcgcctggcgg
ctcaaggaggggtacacggagacgtggaccctgtacgacctgtcggatcgactcaggatg
aagggctggctcgtgcccgcctatccgctggccgacgatctggcgcacctgaccgtgctg
cgcatcgtggtccgggtcggcctgggacgcgacctggccgccgcgctgatcaaggacctc
gccggcgaggtgatgttcctcgaccagctcgactcaccgatgccgcgcaagggccccggg
tcgcacttccaccactga

DBGET integrated database retrieval system