KEGG   Dietzia sp. JS16-p6b: CT688_08445Help
Entry
CT688_08445       CDS       T05397                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
diz  Dietzia sp. JS16-p6b
Pathway
diz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
diz01100  Metabolic pathways
diz01110  Biosynthesis of secondary metabolites
diz01130  Biosynthesis of antibiotics
diz01230  Biosynthesis of amino acids
Module
diz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:diz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT688_08445
Enzymes [BR:diz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CT688_08445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 AAA AAA_17 AAA_22 AAA_28 AAA_5 Cytidylate_kin AAA_16 Zeta_toxin RuvB_N AAA_30 Mg_chelatase AAA_25 SRP54 AAA_24 ABC_tran cobW TsaE NTPase_1 6PF2K RNA_helicase Hydin_ADK DUF2075
Motif
Other DBs
NCBI-ProteinID: AVZ39498
UniProt: A0A2S0QFQ4
LinkDB All DBs
Position
complement(1856949..1857500)
Genome map
AA seq 183 aa AA seqDB search
MNHPARPVAVLVGPPGAGKTTIGRKLARRLDVPFRDADQMIEEAEGRSIPEIFAEEGEPA
FRAIEERVVGEALETFSGVLSLGGGAVLSATTRGRLRGHRVIHLTIGVAEGVRRSRGAGR
PLLAGGDVTARYQALLTERAPLYREVAWSTVSTERRSSGKVVTEIVDRLESGDPHARSAA
DRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacccggcacggccggtcgccgtcctggtgggtccgccgggtgccggcaagacg
accatcgggcgcaagctggcccgcaggctcgacgttccgttccgtgatgccgatcagatg
atcgaggaggccgaggggcggtcgattcccgagatcttcgcggaggagggtgaacccgcg
ttccgcgcgatcgaggagagggtcgtgggggaggcgctggagaccttcagcggggtcctc
tcgctggggggcggtgccgtgctgtcggcgaccacccgcggccggctccgcggtcaccgc
gtgatccatctgacgatcggggtggccgagggggtgcgcaggtcccggggcgccggtcgc
ccactcctcgccggcggtgacgtgacggcgcggtaccaggcgttgttgaccgagcgggcg
ccgctctaccgggaggtcgcgtggtcgaccgtgagcaccgagcgcaggagttcgggcaag
gtggtgacggagatcgtcgacagactcgagtccggtgacccgcacgcgcgcagcgcggcg
gaccgatcgtga

DBGET integrated database retrieval system