KEGG   Dietzia sp. JS16-p6b: CT688_10115Help
Entry
CT688_10115       CDS       T05397                                 

Definition
(GenBank) mismatch-specific DNA-glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
diz  Dietzia sp. JS16-p6b
Pathway
diz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:diz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CT688_10115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:diz03400]
    CT688_10115
Enzymes [BR:diz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     CT688_10115
DNA repair and recombination proteins [BR:diz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CT688_10115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AVZ39766
UniProt: A0A2S0QGB1
LinkDB All DBs
Position
complement(2212385..2213053)
Genome map
AA seq 222 aa AA seqDB search
MAQLVVTGIPRRPSPMGGRRPKRDELARFATADPHAVDDVLPADAEQLRLLIVGVNPGLW
TAAVNAPFARPGNRFWPSLHRAGLTDHVVDAAEGLSAPDEQQLLSRGLGMTNLVGRATAR
ADELTREELRAGAERVTTLAGELKPRVVAVAGITAFRTAFALPKAGYGKQNTSEVAGWPG
EVTLWVLPQPSGLNAHETLDSLAEHWREVWNAVEESRHSAAG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttggtcgtgaccggcattccacggcgcccctcaccgatgggcgggcgccgc
ccgaagcgcgacgagctggcccggttcgccaccgcggacccacacgcggtcgacgacgtc
ctgcccgccgacgccgagcagctgcgacttctcatcgtcggggtcaatccgggcttgtgg
accgcggccgtcaacgcgcccttcgcgaggccgggaaaccggttctggccgtcactgcac
cgggcggggctgaccgatcacgtcgtggatgccgcggagggactgtcggccccggacgag
caacagctcctctcgcgggggctcgggatgacgaatctcgtgggccgggcgaccgcgagg
gcggacgaactcacccgggaggaactgcgcgcgggcgcggagcgcgtgacgacgctggcc
ggggaactgaagccccgagtcgtggccgtcgcggggatcacggccttccggaccgcgttc
gcactgccgaaggctggttacgggaagcagaacacctcggaggtcgctgggtggcccggc
gaggtcacgctgtgggtgctcccgcagcccagcgggttgaacgcgcacgagactctcgac
tccctggccgaacactggcgggaggtctggaacgcggtcgaggagagtcggcactccgcc
gcgggctga

DBGET integrated database retrieval system