KEGG   Dietzia sp. JS16-p6b: CT688_13405Help
Entry
CT688_13405       CDS       T05397                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
diz  Dietzia sp. JS16-p6b
Pathway
diz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:diz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CT688_13405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:diz03400]
    CT688_13405
Enzymes [BR:diz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CT688_13405
DNA repair and recombination proteins [BR:diz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CT688_13405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AVZ40318
UniProt: A0A2S0QI27
LinkDB All DBs
Position
2912584..2915301
Genome map
AA seq 905 aa AA seqDB search
MASKGGKESVEVDGRTIRFTHPDKVLYEATGTTKADVLEYYLAVAPLLMTYAGQRPVTRK
RWPDGTEDKSFFEKNLPSHTPDWVSRVAIEHSSRTVTYPVLDSPATLAWFAQQAALELHV
PQWTLTDGEPGRTRRIVIDLDPGQDVDLDTTAKVALRVRDLLTEAGLASYAVTSGSKGIH
LYARLDKAVTAKGASAVAKQIAQSLAKQTPDLVTATMKRSIRDGKVFVDWSQNSGAKTTV
APYSLRGRAEPWVAAPRSWEELGDGGLTHLHWDEMLKRLESEGDLLEGLEGPAKKGGGSK
KNATKKSATKKSSASREKKSASSKKSSSSSSDDGDPERGSSDSSGADSGDSDSGSDDSGS
DDSTRAAAEEGCDTGPTDADAVVTSLEEYRRKRDRRKTPEPFDGEVETDRSDDDGPIFVI
QEHHARRLHYDLRLEHHGVLASWAVPKNLPTEPKDRRLAVNTEDHPLGYETFEGTIPKGE
YGAGHMTIWDRGTYECEKWKPDEIIVWLHGEKVSGRYVLIRTNAEKNQWIVQYMKDQSPD
SFYGGRDNPKSSYPSDNDRSGGSDTSRSRESGDSTTRRSEAGQNRDSDMADRPDSPPLPM
IPTSGSVTSLPEDTWAFEGKWDGYRVTVATDGRQSRVMSRNGNSMDWLADGFPGLAQAIG
KPAVLDGELVVPGPDGVPEFSALAKQAAAEGDDSSIGPVHLFVFDVLGLDGVDLRRERWE
RRREVLDLLTPALEEVERVHVPGVLDGPGDRALDEAEEFGWEGIVAKRRDSHYQSGRRAK
TWLKEKLLTTTEAVVGGWRPGKGGRSGSLGSLLLGLPAHTGLTYIGRVGTGFSDRQGKAL
LEELEPLRRKTSPFLEDLPSDARRDAIWVLPKLVVEVRHQGFTEEGVLRQSSWRDIRRDK
LPGDL
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaagggcggcaaggagtcggtcgaggtcgacgggcggacgatccgtttcacc
caccccgacaaggtgctctacgaggccaccggcaccaccaaagccgatgtgctggagtac
tacctcgcggtggcgccgctcctcatgacgtacgccggtcagcgtcccgtgacgcgcaag
cgctggcccgacggcaccgaggacaagtccttcttcgagaagaacctgccctcccacacg
cccgactgggtctcgcgggtggcgatcgagcactcctcgcgcaccgtcacctacccggtg
ctcgactcccccgccacgctggcgtggttcgcccagcaggccgcgctcgagctccacgtg
ccgcagtggaccctgaccgacggcgagccggggcggaccaggcggatcgtcatcgacctg
gaccccggccaggacgtcgacctggacacgacggcgaaggtcgccctgcgcgtccgggat
ctcctcaccgaggcgggcctggcctcctacgccgtgaccagcggatccaagggcatccac
ctctacgcccggctggacaaggccgtcaccgccaagggcgcctccgcggtggccaagcag
atcgcccagtcgctggccaagcagaccccggacctggtcaccgccaccatgaagcgctct
atccgcgacggcaaggtgttcgtggactggagccaaaacagtggcgccaagacgaccgtc
gcgccctactccctacgcgggcgcgccgagccgtgggttgctgccccgcgctcgtgggag
gaactcggtgacggcgggctcacgcacctgcactgggacgagatgctcaagcgactggag
tccgaaggcgacctgctcgaaggccttgagggacccgcgaagaagggcggcgggtcgaag
aagaatgccaccaagaagtccgccactaagaagtcctcggcatcgcgagagaagaagtcc
gcgagcagcaagaagtcctcgtcgtcctcatcggatgacggggaccccgagcgcggcagt
tccgattcttccggcgccgattccggcgactccgactccggcagcgacgactccggcagc
gacgactccacccgcgccgcagccgaggaaggctgcgacaccggccccaccgacgccgac
gccgtggtgaccagcctcgaggagtaccgccgcaagcgcgaccgccgcaagaccccggag
ccgttcgacggcgaggtcgagaccgaccgctccgacgacgacggcccgatcttcgtaatc
caggagcaccacgcccgccgcctgcactacgacctgcggctcgaacatcacggcgtgctg
gcgtcgtgggcggtgcccaagaacctgcctaccgaaccgaaggaccggcggctggccgtc
aacaccgaggaccacccgctcggctacgagacgttcgagggcaccatccccaagggcgag
tacggcgccggccacatgactatctgggaccgcggaacctacgagtgcgagaagtggaag
cccgacgagatcatcgtgtggctgcacggtgagaaggtctccggccggtacgtgttgata
cgcacgaacgccgagaagaaccagtggatcgtgcagtatatgaaggaccagtcgccggac
tcgttctacggcggacgcgacaaccccaagtcgtcgtacccctcggataacgaccgctcc
ggggggtcagacacgtcgcggtcccgcgagtcgggcgactcgactacccgccgttcggaa
gctgggcagaaccgcgactcggacatggccgatcgccccgactctccccctctgccgatg
atccccacctcggggtcggtgacatccttgcccgaggacacgtgggccttcgagggcaag
tgggacggctaccgggtgaccgtggcgaccgatggccgacagagcagggtgatgagccgc
aacggcaactcgatggactggctggccgacggcttccccgggctggcgcaggcgatcggg
aagcccgcggtgctcgacggcgagctggtcgtgcccggcccggacggcgtgcccgagttc
tccgcactggccaaacaggccgccgcggaaggagacgactcgtcgatcggcccggtgcac
ttgttcgtctttgacgtcctgggactcgacggcgtggacctccgccgagaacggtgggag
cggcgtcgcgaggtgttagacctgttgacgccggcactcgaggaggtcgagcgggtccac
gtgccgggcgtgctcgacggacccggcgaccgcgcactggacgaggccgaggaattcggc
tgggagggcatcgtggccaaacgccgggactcgcactaccagtcgggaaggcgggccaag
acctggctcaaggagaagctgctcaccaccaccgaggccgtggtgggcggctggcggccg
ggcaagggcgggcgctccggctcgctcggctcactgctgctcgggctgcccgcgcacacg
gggctgacctacatcggccgcgtgggcaccggcttctccgaccggcagggcaaggcgctg
ctcgaggagctcgaaccgctgcgccgcaagaccagcccgttcctcgaggacctgccgtcc
gacgcccgccgcgacgccatctgggtgctgcccaagctcgtggtggaggtccgccaccag
ggcttcaccgaggagggggtgctgcggcagtcctcatggcgggacatccgccgagacaag
ctgcccggggatctctag

DBGET integrated database retrieval system