KEGG   Dyella japonica: HY57_09580Help
Entry
HY57_09580        CDS       T03215                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
dja  Dyella japonica
Pathway
dja00380  Tryptophan metabolism
dja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    HY57_09580
Enzymes [BR:dja01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     HY57_09580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIF47507
UniProt: A0A075K185
LinkDB All DBs
Position
complement(2277923..2279203)
Genome map
AA seq 426 aa AA seqDB search
MSAPYEATLAWAQAQDAADPLRGFRDEFLIPPHEGRDSHYFCGNSLGLQPRAVRAALQAE
LDDWAALAVEGHFKGRLPWMDYHEFVRDDLATVVGAQPSEVVAMNTLGVNLHLMMVSFYR
PTPERHAILIEAGSFPTDRYAVESQVRFHGYDPATSLIELQGDEANGTISMEAIERVLAE
HGSRIALVMLPGIQYRTGQAFDLAAITRLAQRHGCMVGFDLAHAVGNLPLRLHDIGADFA
IWCSYKYLNSGPGAVGGAFVHERHARTTLPRFAGWWGHDKTTRFQMGPEFVPTYGADGWQ
LSNPPILALAPLRVSLEIFVRAGMSNLREKSLRLTGYLEWLVQTQLNDVLEVVTPSDPAR
RGSQLSLRVQGGRARGRALFEYLMGHGIVGDWREPDVIRISPTPLYNRFADCVAFVEAVR
AWHRGG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctccgtacgaagccaccctcgcctgggcgcaggcccaggatgccgccgacccg
ctgcgcggtttccgcgacgagttcctgatccctccgcacgaggggcgcgacagccactac
ttctgtggcaattcgctgggcctgcagccacgcgccgtgcgcgcggcactgcaggcggaa
ctggacgattgggccgcactggcggtggagggccacttcaagggccgcctgccgtggatg
gattaccacgagttcgtgcgcgacgacctggccaccgtggtcggcgcacagccgtccgaa
gtggtggcgatgaataccctgggcgtgaacctgcacctgatgatggtgagcttctaccgc
cccacgccggagcgccacgccatcctgatcgaggcgggctcgttccccacggatcgctat
gcggtggaatcgcaggtgcgcttccacggttacgatccggccacatcgttgatcgaactg
cagggtgacgaggcgaacggcaccatttcgatggaagccatcgaacgtgtgctggccgaa
cacggctcgcgcatcgcgctggtgatgctgccgggcatccaataccgcacgggccaggcc
ttcgatctcgccgcgatcacccgcctcgcgcagcgccatggttgcatggtgggtttcgat
ctcgcgcacgccgtgggcaacctgcccttgcggttgcacgacatcggcgccgacttcgcc
atctggtgcagctacaagtacctcaacagcggccccggtgccgtcggcggcgccttcgtg
catgagcgccacgcgcgcaccaccttgccgcgcttcgccggctggtggggacacgacaag
accacgcgtttccagatgggaccggagttcgtgcccacctatggcgcggatggctggcag
ctgagcaatccaccgatcctcgcgttggcgccgctacgtgtatcgctggagatcttcgtg
cgcgcgggcatgtcgaacctacgcgaaaagtcgctgcgcctcaccggctatctggaatgg
ctggtgcagacgcagctcaacgacgtgctggaagtcgtaacccccagcgaccccgcacgc
cgcggatcgcagctgtcccttcgcgtacagggcggccgtgcgcgtggccgcgcgctgttc
gagtacctgatgggacacggcatcgtcggcgactggcgcgaaccggacgtgatccgcatt
tcgcccacgccgttgtacaaccgctttgccgattgcgtggcattcgtcgaggcggtcagg
gcatggcatcgcggcggctga

DBGET integrated database retrieval system