KEGG   Dyella japonica: HY57_11790Help
Entry
HY57_11790        CDS       T03215                                 

Definition
(GenBank) DNA polymerase
Organism
dja  Dyella japonica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIF47895
UniProt: A0A075K234
LinkDB All DBs
Position
complement(2773829..2774707)
Genome map
AA seq 292 aa AA seqDB search
MMLTHPERIVFPDCGLTKQDVAHYYQSVMSCFLPGVKGRPTSVYRFPEGIAKPGFFQKHP
MRGLHHTGHVSLREESGERDDYLCPTDAAAIIELVQYGALEFHPWAARAGSLEEPDYLVF
DLDPGDGVPWQDVIEAARLVRDRLAKVALKSFVRTTGGKGLHVLVPLHASCRWEDAKRFS
SAFAHHLSDRQPTAFTATSVLAERKGRIFVDYLRNTRGATSVASWSLRARSGAPVAMPLR
WQELGRCASGGAFDLPSAMRRLSRLRGSPWEGFSTMRQPLDRALQVYAPTEG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgatgttgacccatcccgagcgcatcgtatttcccgattgcggcctcaccaagcaggac
gtcgcccattactaccagagcgtgatgtcgtgctttctccctggggtgaagggccgtcct
acgtcggtgtatcgctttcctgagggcatcgccaaacccgggtttttccagaagcacccg
atgcggggcctgcaccatacgggccatgtcagcttgcgcgaggaaagcggtgaacgggat
gactacctgtgtccgacggatgcagccgccatcatcgagctggtccagtatggcgcgctg
gagttccatccctgggcggcgcgggcgggctcacttgaagaaccggactatcttgttttc
gatctcgacccgggcgacggcgtgccatggcaggacgtgatcgaggcggcgcggctggtt
cgcgaccggctagccaaggtcgcgctcaagagtttcgtgcgtaccaccggcgggaaagga
ttgcatgtacttgtgccccttcacgcatcgtgccgatgggaagacgccaaacgtttcagc
agtgcatttgcccaccacctgtcggatcggcagcccactgcattcacggcgacctccgtc
ctggccgaacggaaaggccggatttttgtcgactatctgcgcaatacgcgtggcgccacc
agcgtcgcttcctggtcactgcgcgcacgtagcggcgcaccggtcgccatgccactgcgc
tggcaagaactcggccgatgtgcgagtggcggggcgtttgatctcccatcggccatgcgc
cggctatcacgcctgcgtggctccccgtgggaaggattttccacgatgcgccagccactc
gaccgtgcacttcaggtgtacgcgccgaccgaaggctag

DBGET integrated database retrieval system