KEGG   Dyella japonica: HY57_12595Help
Entry
HY57_12595        CDS       T03215                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dja  Dyella japonica
Brite
KEGG Orthology (KO) [BR:dja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HY57_12595
Enzymes [BR:dja01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HY57_12595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin HI0933_like FAD_oxidored Thi4 K_oxygenase DAO FAD_binding_3 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AIF48039
UniProt: A0A075K1E9
LinkDB All DBs
Position
complement(2943961..2945550)
Genome map
AA seq 529 aa AA seqDB search
MLDADLKSQLQAYLEKVVHPIELVASLDAGASSQELKALLEDIAPLSGKISLRLDGTAAR
KPSFTINRVGTDVGVSFAGIPMGHEFTSLVLALLQVGGHPSKATQDVIEQVRNLDGQFRF
ETFMSLSCHSCPDTVQALNLMSVLNPNISHVAIDGALFQDEVNERQVMAVPTVFLNGEFF
DTGRMEIEQIAARLDTNAHERAAERLNAKAPFDVLVVGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVPYTEGPQLAASLEQHVHEYDVDVMNLQRAEQLIPATTEGG
LHEVRLANGATLKAKTVILSTGARWRNMNVPGEQEYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLLEFDGKLRADDVLQRKLRSLPNVDIIVSAQTTEVAGDG
QKVTALHYTDRASGQHHQVALEGVFVQIGLLPNTDWLKGTVQLSPRNEIEVDARGETSVP
GVFAAGDVTTVPYKQIIIAMGEGSKASLSAFDYLIRLPVDEPAKESVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgccgatctgaagtcccaactgcaggcctaccttgaaaaggtcgtacacccg
atcgagctggtggcctccctcgatgctggcgcgagctcgcaggagctgaaggcgctgctg
gaagacatcgccccgctgtcgggcaagatttcgctgcgcctcgacggcacggcggcacgc
aagccgtcgttcaccatcaaccgcgtcggcaccgacgtgggcgtgagctttgccggcatt
ccgatgggtcatgagttcacctcgctggtgctggccctgctgcaagtgggcggccacccg
tccaaggccacgcaggacgtgatcgaacaggtgcgcaacctcgacgggcagttccgtttc
gagaccttcatgtcgttgtcctgccacagctgcccggacaccgtgcaggcgctgaacctg
atgagcgtgctcaacccgaacatctcgcacgtcgccatcgacggcgcactgttccaggac
gaggtaaacgagcgccaggtgatggcggttcccaccgtattcctcaatggcgaattcttt
gacaccggccgcatggagatcgagcagatcgccgcgcgactggacaccaacgcccatgaa
cgcgctgccgaacgcctgaacgccaaggcgccgttcgatgtcctggtggtcggcggcggc
cccgccggcgcggcggcggccgtgtatgcggcgcgcaagggcatccgcaccggcgtagcg
gcggagcgcttcggcggccaggtgctggacaccatggccatcgagaactttatttccgtg
ccgtataccgaaggcccgcagctcgccgcctcgctggagcagcacgtgcacgagtacgac
gtggacgtgatgaacctgcagcgcgcggagcaactgattccggccaccaccgaaggcggc
ctgcatgaagtgcggctcgccaacggcgccacgctgaaggcgaagacggtgatcctttcc
accggcgcccgctggcgcaacatgaacgtgccgggtgaacaggagtaccgcaacaagggc
gtcacctattgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagcggccatcgacctggccggcatcgtcggtcatgtc
accctgctcgagttcgacggcaagctgcgcgcggacgacgttctgcagcgcaagctgcgc
agcctgccgaacgtggacatcatcgtcagcgcgcagaccacggaagtagccggcgacggc
cagaaggtgacggcactgcactacaccgaccgcgcgagcggccagcatcaccaggtggcg
ctcgagggcgtgttcgtgcagatcggcctgctgcccaacaccgactggctgaagggcaca
gtccagctgtccccgcgcaacgagatcgaggtggacgcgcgtggcgagacgtccgtgccg
ggcgtgttcgccgccggcgatgtcaccaccgtgccttacaagcagatcatcatcgcgatg
ggcgaaggctccaaggcctcgctgagtgccttcgactacctgatccgcctgccggtggat
gagcccgcgaaggaaagcgtcgccgcctga

DBGET integrated database retrieval system