KEGG   Dyella japonica: HY57_16300Help
Entry
HY57_16300        CDS       T03215                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dja  Dyella japonica
Brite
KEGG Orthology (KO) [BR:dja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dja01001]
    HY57_16300
Enzymes [BR:dja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HY57_16300
Protein kinases [BR:dja01001]
 Serine/threonine kinases: Other
  Bacterial family
   HY57_16300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_12 TPR_10 TPR_2 TPR_1 TPR_8 TPR_7 TPR_16 Kdo TPR_14 Haspin_kinase Kinase-like TPR_4 TPR_11
Motif
Other DBs
NCBI-ProteinID: AIF48686
UniProt: A0A075K371
LinkDB All DBs
Position
3815059..3817869
Genome map
AA seq 936 aa AA seqDB search
MISAFAQRWHEIEPLIDQLFEVPVAEREAWLRLHCHDLTLRALVAQALDNAPGVEALERG
MEQWLPGFAGDAADTLPTIAGYRVLRFVGAGGMASVFEAERDLPGGPQTVALKLLRIDVH
DADERRRFLREQRILARLQHPHIAQLLDAGFSPTGTPFLALEFVAGDDLMSHCALRGLSV
RERLALFMDVCAAVDHAHRSLIVHRDLKPNNVLVGKDGGVKLVDFGIAKLLTGDGERTRT
EARRLTRSYAAPEQLAGDAATTAIDVYALGVLLAELLGEQPPHRADGQVDAKASVFDDES
LRKKLGVDLHAIVQEATHADPARRYASAAALSADIQRYLEGKPLQARTDTLAYRAVTFAR
RHAMAVSIAVVIAAVLAATTVAGLHEARLARQSARDARAQALAAASEAHRAGALKTFLEG
LFDSSAHGTEANETAEELLARGRERADHDFATQPALRAEILALVGDLERRSGHPERAWQP
LEEAAALARAQFGATDRRTLHIEYLLAKEADELGRVREATARLQSAVDAFEAGPNRGVPE
EVQALAWLAGLDERLGDSARAIAMGEQDVALARRILPKDSEALTEAALNLGWIYMDAGRP
ERAVPLLREALARKQVHLGARHADVADAMAILTSALTRLGRYGEGEQLMRDAVAIDASAY
THPNAHTAWHLNDLGGVFFLEGRYDEAAAFYTKSIAIDQALAPSSGLNEATSIGNIGKLR
FRQGAYAEAEARLRDSIERRQRLLGVDYADNGRAYDHACLAEVLIARGDFTGARAALDDA
LAESRQRHRDAHPDTAFALAVDAELMATAGDDERAATLAGQAVDMYATLGDRQSEKAIRA
RLVYGDILQVLGRQAEAASQLDAALAAANAAEPAPPALVARIAADLAHVDASLGDRTATE
RLREQARASLANAEAGPNTDRDAAVHLLAGTKLVAR
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgatctccgccttcgcccaacgctggcacgaaatcgaacccctgatcgaccagttgttc
gaggtgcctgtcgccgagcgggaggcatggctgcgcttgcactgccatgacctcaccctg
cgcgcgctggtggcacaggcgctggacaacgcccccggcgtagaggcactggaacgtggc
atggagcagtggttgccggggttcgccggtgacgcggccgacaccttgccgaccatcgcc
ggctatcgcgtgctccgcttcgttggcgcaggcggcatggccagcgtgttcgaagccgag
cgcgaccttcccggcggcccgcagacggtggctctcaagctgttgcgcatcgatgtgcac
gatgccgacgagcggcggcgcttcctgcgcgaacaacgcatcctggcgcgcctgcagcat
ccccacatcgcgcagctgctcgacgcgggattttcccccaccggaacgcccttcctcgcg
ctcgaattcgtcgcgggcgacgacctgatgtcgcactgcgcgctgcgcggcctgtccgtg
cgcgagcggctcgccctgttcatggatgtctgcgcggcggtggaccatgcgcaccgcagc
ctgatcgtgcaccgcgacctgaagcccaacaacgtgctggtcggcaaggacggtggcgtc
aagctggtggatttcggcatcgccaagctgctcactggcgacggcgaacgcacacgcacc
gaggcacgccgcctgacgcgctcgtatgccgcccccgaacagctggcgggcgatgcggca
acgacggccatcgatgtctatgcgctgggcgttctgctggccgagttgctgggcgaacaa
ccgccgcatcgcgcggacggacaggtcgacgcgaaggcctccgtgtttgacgacgagtcc
ttgcgcaagaagcttggcgtcgatctacacgcgatcgtgcaggaggccacccatgccgat
cctgcgcgccgctacgccagcgcggcggccctcagcgccgacatccagcgctacctcgag
ggcaagcccttgcaggcccggacggacacgctggcgtatcgcgcggtcacctttgcacgg
cggcacgccatggccgtatccatcgctgtcgtcatcgcggctgtactggccgccaccacc
gtggccggcctgcacgaggcgcggcttgcgcgccagtcggcccgggacgcacgagcacag
gccctcgccgccgccagcgaggcgcatcgcgccggcgcactcaagaccttcctcgagggc
ctgttcgacagttccgcgcacggcaccgaagccaacgaaaccgccgaggaactgctggcc
cgcggacgggagcgtgccgaccacgacttcgccacgcaacctgcgctgcgcgccgagatc
cttgccctggtcggtgatcttgagcgccgcagcggccacccggaacgcgcgtggcaaccg
ctggaggaagccgccgcgctggcacgggcgcagttcggcgccaccgaccgccgcaccctg
catatcgaatacctgcttgccaaggaagccgatgaactgggtcgcgtgcgtgaggccacc
gcgcggctgcagagcgccgtggatgcgttcgaagcaggccccaaccgcggcgttcccgag
gaagtgcaggcgcttgcatggcttgccggcctcgacgaacgcctcggcgattcggccagg
gcgatagccatgggcgaacaggatgtggcgctggcccgccgcattcttccgaaagacagc
gaggcgctgaccgaagcggccctcaacctcggctggatctatatggatgccggccgcccg
gaacgtgccgtaccgctgctgcgcgaagcgctggcgcgcaaacaggttcaccttggcgcc
cggcatgccgacgtcgccgacgccatggccatcctcacctcggcactgacccgcctgggc
cgctacggagaaggcgaacagctgatgcgtgacgccgtggccatcgacgccagcgcatac
acccaccccaacgctcatacggcatggcatctcaacgaccttggcggcgtgttcttcctg
gagggtcgctacgatgaggccgccgcgttctacaccaaatccatcgccatcgaccaggcg
ctggcgccttcctccggcctcaacgaagcgacgagcatcggcaacatcggcaagctccgc
tttcggcaaggcgcctatgccgaggcggaagcccgcttgcgcgactcgatcgagcgcagg
caacgcttgctgggtgtggactatgcagacaatggccgcgcctacgaccacgcatgcctg
gccgaggtgctcatcgcgcgcggtgacttcaccggcgcacgggcggccctggacgacgca
ctggccgaaagccggcaacggcatcgcgacgcgcatccggataccgccttcgcgctcgcc
gtcgacgccgaactgatggcgactgctggcgacgacgagcgcgccgccaccctcgccggc
caagccgtggacatgtacgccacgctgggcgaccggcagtcggagaaagccatccgcgcc
cgcctcgtatacggcgacattctgcaggtgctcgggcgccaggcagaggccgcatcccag
ctcgacgcggcgctcgccgccgccaacgcggcagagccggccccgccagcgctggtggcc
cgcatcgccgccgaccttgcgcatgtcgatgcatcactcggcgatcgcacagccaccgag
cgccttcgcgaacaggcccgtgcgtcgctggccaacgccgaggcggggcccaataccgat
cgcgacgcggccgtgcacctgctggcaggcacgaagctggtcgcgcgctga

DBGET integrated database retrieval system