KEGG   Dyella jiangningensis: CH75_02050Help
Entry
CH75_02050        CDS       T03074                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
dji  Dyella jiangningensis
Pathway
dji00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dji01100  Metabolic pathways
dji01110  Biosynthesis of secondary metabolites
dji01130  Biosynthesis of antibiotics
dji01230  Biosynthesis of amino acids
Module
dji_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CH75_02050 (aroK)
Enzymes [BR:dji01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CH75_02050 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA_16 Cytidylate_kin AAA AAA_22 AAA_5 IPT AAA_17 AAA_25 AAA_28 ABC_tran AAA_14 AAA_23
Motif
Other DBs
NCBI-ProteinID: AHX12207
UniProt: A0A023NML1
LinkDB All DBs
Position
complement(469556..470095)
Genome map
AA seq 179 aa AA seqDB search
MNPSCNLFIVGPTGAGKTSIGRRLAEHYGLNFLDLDQEIERQCGVPVSAVFEIEGEAGFR
RRESALLDECSRQRGVLVATGAGAVLDPANRQLLMERGFVLWLQATLEQQLERLAHDKQR
PLLASGDRAERLSAMAQARTPLYRDVADLAIPGEHEHVHAASARSILLIDQHWQRQQAA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcgtgcaacctgttcatcgtcggtccgaccggcgccggcaagacctccatc
ggacgtcggctggccgagcattatgggctgaacttcctcgatctcgaccaggagatcgag
cggcagtgcggtgtaccggtcagcgcggtgttcgagatcgaaggcgaagcgggcttccgt
cgccgcgaaagcgccctgctggacgaatgcagccgccagcgcggcgtgctcgtcgccacg
ggtgccggcgcggtgctcgacccggccaaccgccagttgttgatggagcgcggcttcgtg
ctgtggctacaggccacgctggaacaacagctcgaacgactcgcgcatgacaagcaacgc
ccgctgctcgccagcggcgaccgcgccgagcggctcagcgccatggcgcaggcacgcacg
ccgctctatcgggacgtcgcggacctggcgattcccggcgaacacgaacatgtccacgcc
gccagcgcgcgcagcattcttctgatcgatcaacactggcaacgccagcaagccgcatga

DBGET integrated database retrieval system