KEGG   Dyella jiangningensis: CH75_05610Help
Entry
CH75_05610        CDS       T03074                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dji  Dyella jiangningensis
Pathway
dji00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH75_05610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dji02000]
    CH75_05610
Enzymes [BR:dji01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH75_05610
Transporters [BR:dji02000]
 Other Transporters
  Pores ion channels [TC:1]
   CH75_05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_C_2 GST_N_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AHX12821
UniProt: A0A023NPJ3
LinkDB All DBs
Position
1209679..1210296
Genome map
AA seq 205 aa AA seqDB search
MKLYYAAGACSLSPHIVALEAGIPLELEKVDTKEKRTASGADYWQINPKGYVPALMLDNG
ELLTEGPAIVQYLADQKPDAKLAPANGTAARYRLQEMLGYINSELHKTYTPLFKPDTPDA
VRQERKEYLRKRYALLEQHLAKHDWLVGEHFSVADAYLFTVTNWSKHVALDLSDFPALLA
FQKRVGERPNVQAAMVAEGLTKAAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacgccgccggcgcctgctcgctttccccgcacatcgttgccctggaa
gcgggcattccgctggaactggagaaggtggacacgaaggaaaagcgcacggcgagcggt
gccgactattggcagatcaatcccaagggctacgtgccggccctgatgctggacaacggc
gaactgctcaccgaaggcccggccatcgtgcagtacctcgccgaccagaagcccgacgcc
aagctggcgccagccaacggcacggcagcgcgttaccgtctgcaggagatgctgggctac
atcaactccgagctgcacaagacctatacgccgttgttcaagccggacacgccggatgcg
gtgcgtcaggagcgcaaggagtacctgcgcaagcgctacgccttgctcgaacaacatctg
gccaagcacgactggctggtcggcgagcacttcagcgtggcggatgcttatctcttcacc
gtcaccaactggtccaagcacgtggcgctggatctttcggacttccctgcattgctggca
ttccagaagcgcgtgggtgaacggccgaacgtgcaagcggcgatggtggcggaggggctg
accaaggcagctgcctga

DBGET integrated database retrieval system