KEGG   Dyella jiangningensis: CH75_07745Help
Entry
CH75_07745        CDS       T03074                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dji  Dyella jiangningensis
Brite
KEGG Orthology (KO) [BR:dji00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CH75_07745
Enzymes [BR:dji01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CH75_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 K_oxygenase FMO-like Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHX13142
UniProt: A0A023NPM8
LinkDB All DBs
Position
complement(1637471..1639060)
Genome map
AA seq 529 aa AA seqDB search
MLDADLKTQLQAYLEKVVHPIELVASLDNGEKSQELKGLLEDIASLSSQVSARYDGNDAR
KPSFAINRVGTDVSVRFAGIPMGHEFTSLVLALLQVGGHPSKATQEVIEQVRNLEGEFRF
ETFMSLSCHSCPDTVQALNLMSVLNPNIKHVAIDGALFQSEVDERQVMSVPTVFLNGELF
DTGRMSIEQIAGRLDANASERAAEKLKNKAPFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVTYTEGPKLAAALEQHVHEYDVDVMNLQRAEKLIPASTEGG
LHEIVLANGASLKSKTVILSTGARWRNMNVPGEQEYRNKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLLEFDGKLRADEVLQRKLRSLPNVDVIVSAQTTEVQGDG
QKVTGLTYTDRTSGDSRQVALEGVFVQIGLLPNTEWLKGTVQLSPRGEIEVDSRGETSVP
GVFAAGDVTTVPYKQIVIAMGEGSKASLSAFDYLIRLPVEETAKEAVVA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccgatctgaagacccagttgcaggcctacctcgaaaaggtcgtccacccg
atcgagctcgtggcctccctcgacaacggcgagaagtcgcaggaattgaaaggcctgctc
gaagacatcgcctcgctgtccagccaggtatcggcccgttacgacggcaacgatgcgcgc
aagccgtccttcgcgatcaatcgcgtgggcacggacgtgagcgtgcgtttcgccggcatc
ccgatgggccacgaattcacctcgctcgtgctcgccctgctccaggtcggcggccatccg
tccaaggccacgcaggaagtgatcgagcaggtgcgcaacctcgaaggcgagttccgtttc
gagactttcatgtcgctctcgtgccacagctgcccggacaccgtgcaggcgctgaacctg
atgagcgtgctcaaccccaacatcaagcacgtggcgatcgacggcgcgctgttccagagc
gaagtggacgagcgccaggtgatgtcggtgccgaccgtattcctcaacggtgagctgttc
gacaccggccgcatgtcaatcgagcaaatcgccggtcgcctggacgccaacgccagcgag
cgcgctgccgagaagctgaagaacaaggcaccgttcgacgtgctggtgatcggcggtggc
ccggcgggtgcagcggcggcgatctacgccgcgcgcaagggcatccgcaccggcgtggcc
gctgagcgtttcggcggacaggtactggacaccatggcgatcgagaacttcatctcggtc
acatataccgaaggccccaagctggctgccgcgctggagcagcacgtgcacgaatacgac
gtggacgtcatgaacctgcagcgcgcggaaaaattgattccggcgtcgaccgaaggcggc
ctgcatgagatcgtgctcgccaacggcgcgtcattgaagtcgaagacggtgatcctctcc
accggtgcgcgctggcgcaacatgaacgtgccgggcgagcaggagtaccgcaacaagggc
gtgacgtattgcccgcactgcgatggtccgttgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattcgggcgtcgaggcggcgatcgacctggccggcatcgtgggccacgtc
accctgcttgaattcgacggcaagctgcgtgcggacgaggtgttgcagcgcaagctgcgc
agcctgccgaacgtggacgtgatcgtcagcgcgcagaccaccgaggtgcagggcgacggc
cagaaggtcaccggcctcacctacaccgaccgcaccagcggcgacagccgccaggtggcg
ctggaaggtgtgttcgtgcagatcggcctgctgcccaacaccgaatggctgaagggcacg
gtgcagttgtcgccgcgcggcgagatcgaagtcgactcgcgtggcgaaacctcggtccct
ggtgtgttcgccgcaggcgacgtgaccacagtgccgtacaagcagatcgtgattgcgatg
ggcgaaggctccaaggcctcgctgagcgccttcgattacctcatccgcctgccagtggaa
gaaacggcgaaggaagccgtcgtcgcctga

DBGET integrated database retrieval system