KEGG   Dyella jiangningensis: CH75_12375Help
Entry
CH75_12375        CDS       T03074                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
dji  Dyella jiangningensis
Pathway
dji00260  Glycine, serine and threonine metabolism
dji01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CH75_12375
Enzymes [BR:dji01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     CH75_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AHX13903
UniProt: A0A023NTZ4
LinkDB All DBs
Position
2676701..2677735
Genome map
AA seq 344 aa AA seqDB search
MPQTMKALVKRKPEQGIWMEEVPVPEVGPNEVLIKMEKTAICGTDLHIYKWDDWSQRTIK
PGLTIGHEFVGRIVEIGPGVTGYKIGDRVSAEGHIVCGHCRNCRAGRQHLCPNTVGIGVN
RNGAFAEYMTMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFDMIGEDVLITGAGPIG
IIAAGIAKHVGARNVVVTDINDYRLKLAADMGATRVVNVANQSLKDVMKDLHMEGFDVGL
EMSGNPRAFNDMLECMYHGGKIAMLGIMPRGAGIDWDKVIFKGLTLQGIYGRRMYETWYK
MTQMVLTGFPLQKVLTHQIHIDDFQKGFDLMDAGKCGKVVCSWS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagacgatgaaagccctggtcaagcgcaagcccgagcagggcatctggatggaa
gaagtgcccgtccccgaggtcggccccaacgaggtgctgatcaagatggaaaagaccgcg
atctgcggcaccgacctgcacatctacaagtgggacgactggtcccagcgcaccatcaag
cccggcctgaccatcggccacgagttcgtcggccgcatcgtggaaatcggccccggcgtc
accggctacaagatcggcgaccgcgtctcggccgaaggtcacatcgtgtgcggccactgc
cgcaactgccgcgccggccgccagcacctgtgcccgaacaccgtgggcatcggcgtgaac
cgcaatggcgcgttcgccgagtacatgaccatgccggcctcgaacctgtggccgatcccc
gaccagattccgtccgagctggccgccttcttcgatccttatggcaacgccgcgcactgc
gcgctggaattcgacatgatcggcgaagacgtgctgatcaccggcgcgggcccgatcggc
atcatcgccgccggcatcgccaagcacgtgggcgcacgcaacgtcgtggtcaccgacatc
aacgactaccgcctcaagctggcggcggacatgggcgccacccgcgtggtgaacgtggcc
aaccagtcgctgaaggacgtgatgaaggatctgcacatggaaggcttcgacgtgggcctg
gaaatgagcggcaacccgcgcgccttcaatgacatgctcgagtgcatgtaccacggcggc
aagatcgccatgctcggcatcatgccgcgcggcgcgggcatcgactgggacaaggtgatt
ttcaagggcctcaccctgcagggcatctacggccgtcgcatgtacgagacctggtacaag
atgacccagatggtactcaccggcttcccgctgcagaaggtgctcacgcaccagatccac
atcgacgacttccagaaaggtttcgacctgatggatgcgggcaagtgcggcaaggtcgtg
tgctcctggagctga

DBGET integrated database retrieval system