KEGG   Dyella jiangningensis: CH75_12480Help
Entry
CH75_12480        CDS       T03074                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dji  Dyella jiangningensis
Pathway
dji00020  Citrate cycle (TCA cycle)
dji00270  Cysteine and methionine metabolism
dji00620  Pyruvate metabolism
dji00630  Glyoxylate and dicarboxylate metabolism
dji00680  Methane metabolism
dji01100  Metabolic pathways
dji01110  Biosynthesis of secondary metabolites
dji01120  Microbial metabolism in diverse environments
dji01130  Biosynthesis of antibiotics
dji01200  Carbon metabolism
Module
dji_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dji_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dji_M00012  Glyoxylate cycle
dji_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dji00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CH75_12480
   00620 Pyruvate metabolism
    CH75_12480
   00630 Glyoxylate and dicarboxylate metabolism
    CH75_12480
  Energy metabolism
   00680 Methane metabolism
    CH75_12480
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CH75_12480
Enzymes [BR:dji01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CH75_12480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AHX13922
UniProt: A0A023NRX9
LinkDB All DBs
Position
complement(2703009..2703995)
Genome map
AA seq 328 aa AA seqDB search
MKAPVRVAVTGAAGQIGYALLFRIAAGDMLGPDQPVILHLLEITPALPALQGVVMELNDC
AFPTLAGVVATDDLNVAFKDVDYALLVGARPRGPGMERKDLLEANGAIFGPQGKALNDHA
KRDVRVLVVGNPANTNALIAQQNAPDLDPKCFTAMVRLDHNRALSQLAEKTGKHNTDIKK
MTIWGNHSSTQYPDLHHATVGGKPALSLVDQAWYESDFIPTVQQRGAAIIKARGASSAAS
AASAAVDHMRTWALGTAEGDWVSMGIPSDGSYGIAPGVIYGYPVTVKNGKYEIVQGLEVN
DFSRARMDATDKELREERAGVEHLFAKK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccccgttcgtgttgccgttaccggcgctgccggccagatcggttacgccctg
ctgttccgcatcgccgcgggcgacatgctgggtccggaccagccggtgatcctgcacctg
ctggaaatcaccccggcgctgcccgcgctgcagggcgtggtgatggaactcaacgactgc
gcgttcccgacgctggctggcgtggtcgccaccgacgatctcaacgtcgccttcaaggat
gtggactacgcactgctggtcggcgcacgtccgcgcggcccgggcatggagcgcaaggac
ctgctcgaagccaacggcgccatcttcggcccgcagggcaaggcgctgaacgatcacgcc
aagcgcgacgttcgcgtgctggtggtcggcaacccggccaacaccaatgcgctgatcgcc
cagcagaacgcccctgacctcgatccgaagtgcttcactgcgatggttcgtctcgaccac
aaccgcgcgctgtcgcagctcgccgagaagaccggcaagcacaacaccgacatcaagaag
atgaccatctggggcaaccacagctccacgcagtacccggacctgcaccacgccaccgtc
ggcggcaagccggcgctgtcgctggtcgaccaggcctggtacgagagcgatttcatcccg
accgtgcagcagcgcggcgcggccatcatcaaggcccgtggcgcatcctcggctgcgtcg
gctgcgtcggccgccgtcgaccacatgcgcacctgggcgctgggcaccgcggaaggtgac
tgggtctcgatgggtatcccgtcggacggttcgtacggcatcgcgccgggcgtgatctac
ggctacccggtgaccgtgaagaacggcaagtacgaaatcgtgcagggcctggaagtgaat
gacttctcgcgcgcccgcatggacgccaccgacaaggaactgcgcgaagagcgtgccggc
gtcgagcacctgttcgccaagaagtaa

DBGET integrated database retrieval system