KEGG   Dyella jiangningensis: CH75_22690Help
Entry
CH75_22690        CDS       T03074                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
dji  Dyella jiangningensis
Pathway
dji00550  Peptidoglycan biosynthesis
dji01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CH75_22690
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CH75_22690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dji01011]
    CH75_22690
Enzymes [BR:dji01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CH75_22690
Peptidoglycan biosynthesis and degradation proteins [BR:dji01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CH75_22690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHX15726
UniProt: A0A023NXW0
LinkDB All DBs
Position
4968034..4970046
Genome map
AA seq 670 aa AA seqDB search
MALKRRSIKDSRGESTLFRVRAMVGFALILLGLGVLVGRYQYLQVQRHDEFALRSENNRV
KPRAIPPARGLIYDRNGVLLADNVPAFRLEVVPEQVPDMKTMLSDIRDVVPLGDDDIETF
RKQLKQNRRFDSVPLKLHLTEDEIARFAINRWRFPGVDVVPYLTRRYPYGPLFAHVVGYV
GRIDADDMNRLDPDRYKGTSHVGRSGLERSYEDILHGEPGYELVEVNADGRVQRVLETHA
PTPGKNLYLSIDVRVQKAASDAFDGRPGSTVAIDPRNGQVLAMVSVPSFDPNLFVNGISR
ADYTTYTTDTDKPLLNRALKSAYPPGSTVKPFLALGGLEMGVRRPEDTVLSTGEFCIPGQ
QRCYRDDTRGGDGTVNMVRAIEKSTNTYFYRLALDMGIDRLASWMGSLGFGKKTGIDLIG
EAEGILPSREWKATRSKYGWFPGETVIAGIGQGYWNVTTLQLAHATATFAGHGTPYAPRL
VMATSAVKEHAVPLANPPSGPSLIHKPNDWNVVNQGMEAVVYGAGGTAMQAGVFKGFPLT
VAGKSGTAERFSRRSNEYDTNKNTAYLATRHRAWFIGYTPTEAPRIAVAAMLESGAWGAA
DAGPIVRKIMDAWLVSTGGAVPPSKTPEGPTAPTGVPDVPDDTPVATPADMSALPAESSS
TAPSDDGGTP
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaagcgacgctcgatcaaggattcccgcggcgaaagcacgctgtttcgcgtg
cgcgcgatggtgggcttcgcgctgatcctgctcggcctgggcgtgctggtggggcgttac
cagtacctgcaggtgcagcgccacgacgagtttgcgctgcggtccgagaacaatcgtgtg
aagccacgggcgatcccgccggcgcgcggtctcatctacgatcgcaatggcgtgctgctc
gccgacaacgtgcccgcattccgtctcgaagtggtgcccgagcaggtgcccgacatgaag
acgatgctgtcggacatccgagacgtggtgcccctcggcgacgacgacatcgagacgttc
aggaagcagctcaagcagaaccggcgcttcgacagcgtgccgctgaagctgcacctcacc
gaggacgagatcgcgcgcttcgccatcaatcgctggcgttttcccggcgtggacgtggtg
ccataccttacgcggcgctatccgtacggcccgttgttcgcgcacgtggtgggctatgtg
ggtcgcatcgatgcggacgacatgaaccgtctcgacccggatcgctacaagggcaccagc
catgtcggccgcagcggcctggagcgttcgtacgaggacatcctgcatggcgagccgggc
tacgaactggtcgaggtgaatgcggacggtcgcgtgcagcgcgtgctggagacgcacgca
ccgacgccgggcaagaacctctacctgagcatcgatgtgcgcgtgcagaaggcggcatcc
gatgccttcgacggtcgaccgggttcgaccgtggcgatcgatccacgcaacggccaggtg
ctggctatggtcagcgtgccgagctttgatcccaacctgttcgtcaacgggatcagccgc
gcggactacaccacctatacgacggataccgacaagccgctgctcaaccgtgcgttgaag
agcgcctatccgccgggctccacggtcaagccgtttctcgcgttgggcggcctcgaaatg
ggcgtccgccggccggaggatacggtgttgtccaccggcgaattctgtatcccgggacag
cagcgctgctatcgcgatgacacgcgcggcggcgacggcacggtgaacatggtgcgtgcc
atcgagaaatccaccaatacgtacttctacaggcttgcgctcgacatgggcatcgatcgg
ctggccagctggatgggcagcctgggcttcggcaagaagaccggcatcgacctgatcggc
gaggcggagggcatcctgccgtcgcgcgaatggaaggcgacgcgcagcaagtacggttgg
ttcccgggcgaaaccgtgatcgcaggtatcggccagggttactggaacgtcaccacgctg
cagctggcgcatgccacggcgaccttcgccggtcatggcacgccgtatgcgccgcgcctg
gtgatggcgacgtctgcggtgaaggagcacgccgtgccgttggcgaatccaccttcgggt
ccgtcgctaatccacaagcccaatgactggaacgtggtcaaccaaggcatggaagcggtg
gtgtatggcgccggaggcacggccatgcaggcaggcgtgttcaagggctttccgctgacg
gtggccggcaagagcggtaccgcggagcgcttctcccgtcgcagcaacgagtacgacacc
aataagaacaccgcttacctcgcaacgcgccatcgcgcgtggttcatcggctatacgccc
accgaagcaccgcgtatcgcggttgcggccatgctcgaatcgggcgcctggggtgcggcg
gacgcgggccccatcgtgcgcaagatcatggatgcgtggctggtctcgactggcggcgcg
gtgcctccgagcaagacgccggaaggcccgaccgcgcccacaggcgtgcctgatgtacca
gacgacaccccagtcgccacgccggccgacatgtccgcgttgcccgcggaaagttccagc
acggccccgtccgacgatggaggcaccccatga

DBGET integrated database retrieval system