KEGG   Dyella jiangningensis: CH75_22710Help
Entry
CH75_22710        CDS       T03074                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
dji  Dyella jiangningensis
Pathway
dji00550  Peptidoglycan biosynthesis
dji01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CH75_22710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dji01002]
    CH75_22710
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dji01011]
    CH75_22710
Enzymes [BR:dji01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CH75_22710
Peptidases and inhibitors [BR:dji01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CH75_22710
Peptidoglycan biosynthesis and degradation proteins [BR:dji01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CH75_22710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AHX15730
UniProt: A0A023NYD2
LinkDB All DBs
Position
4973299..4974528
Genome map
AA seq 409 aa AA seqDB search
MNLIRRTLSSLAVAALVVGTAVAQQTPPKPVPVPRPAVPEAPVPPPPDVDGKSWVLMDYA
TGQVLASKEPDMRVEPASITKVMTDYVVSAEVANGKIHMTDPVTISENAWRSGGAGTDGS
TSFLKLNSQVPLKDLLYGMIIQSGNDAAIALAEHSAGSETAFANLMNAYAKQLGMTNTNF
QNASGYPIANHYSTARDIAILSRALIHDFPEDYAISAIKDFEWNGIKQHNRNLLLWRDNT
VDGIKTGHTAAAGFCLAASAKQGDSRMIAIVMGASNEKARADAALALMNYGFRFYETHKL
YDGNKPLATPKLWKGQANQLPLGVADNVLVTVKRGDYDKLKATMDIPATLIAPFTKGQQV
GTLRVTLDGQPVQNVPLIALADAPQAGFFGRLWDSIMLWFHSDKKPDEK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgatccgccgtaccctgtcctcgcttgccgtcgccgccctggtcgtcggcacc
gccgttgcccagcagacgccgcccaagcccgtgccggtgccgcgtccggcggtgcccgag
gcgccggtgccgccgcctccggatgtggacggcaagagctgggtgctgatggattacgcc
accggtcaggtgcttgcgtcgaaagagccggacatgcgcgtggagccggcctcgatcacc
aaggtgatgaccgactacgtcgtctccgccgaggtcgccaacggcaagatccacatgacc
gacccggtcaccatcagcgagaacgcgtggcgcagcggtggtgcgggtaccgacggctcc
accagcttcctcaagctcaacagccaggtgccgctgaaggacctgctgtacggcatgatc
atccagtccggcaatgacgccgccatcgcattggccgagcacagcgcgggctccgaaacc
gcgttcgccaacctgatgaatgcctacgccaagcagctgggcatgaccaacaccaatttc
cagaacgcttcgggctacccgatcgccaaccactactccacggcgcgcgacatcgcgatt
ctttcgcgcgcgttgatccatgatttccccgaggattacgcgatctcggcaatcaaggac
ttcgagtggaacggcatcaagcagcacaaccgcaacctgctgctgtggcgcgacaacacc
gtggacggcatcaagacgggccacacggccgcggctggtttctgcctggctgcctcggcc
aagcagggtgattcgcgcatgatcgccatcgtgatgggcgcctccaacgaaaaggcccgt
gccgatgccgcgctggcgctgatgaactacggtttccgcttctacgagacacacaagctg
tatgacggcaacaagccgttggcgacgccgaagctgtggaagggccaggcgaaccagctg
cctctgggcgtggccgacaacgtgctggtgaccgtcaagcgcggcgactacgacaagctc
aaggccaccatggacatcccggctacgctgatcgccccgttcacgaagggccagcaggtc
ggtacgctgcgagtcacgttggacggccagccggtgcagaacgtgccgctgatcgccctg
gccgatgcgccgcaggccggcttctttggccgcctgtgggacagcatcatgctgtggttc
cacagcgacaagaagcccgacgagaagtga

DBGET integrated database retrieval system