KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0881Help
Entry
DKAM_0881         CDS       T00817                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00564  Glycerophospholipid metabolism
dka01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dka00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DKAM_0881
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DKAM_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 NAD_binding_8 Pyr_redox FAD_binding_2 Pyr_redox_3 Lycopene_cycl Thi4 TrkA_N FAD_binding_3 K_oxygenase 3HCDH_N NAD_binding_9 UDPG_MGDP_dh_N AlaDh_PNT_C Sacchrp_dh_NADP Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ACL11207
UniProt: B8D526
LinkDB All DBs
Position
complement(843521..844999)
Genome map
AA seq 492 aa AA seqDB search
MRIVIIGAGVVGLSIARVLSMYKGLDIVVVEKEPDVGWGASKANTSIIHPGHEEDPELHP
LRARLCVEGNKLWRQWVKELDIPAKWPGELMVFTNSEEEKEALRYIDTARRNNVPGVRAV
YGDELRRLEPAISPMAVGAVYAPTAGNISPFEAVAALAENLVENGGRILVNTLVKSVRIK
DKAVEGVETSGGFIQADIVINAAGVHADEISHSAGVEEDFVIRPRKGEYIVFDEDTSVKP
LRLLHTTPTSLTKGVYAITTTGGDLLIGPTAVDMPYELKEDTSTTLEGIEYLLREAGKLL
RELPPRSLITRTFAGVRPEPPHGEWLIKVYEEPWGFINVAGIRSPGLTAAPAIAYYVADM
ISKSYAVSLEHRSDWKPYRRGFLRLHGKSLREIDELVSVNPDYGEVICYCRTVSKAEILE
AVKRIKTIGAQVTLDGVKFRTKAGFGRCQGSFCRWRIAGIIAGLEGKEMHEVVVKMERYG
LGDVKKMLREEA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagttatcattggagccggtgtagtagggttatccatcgcaagagtcctcagc
atgtataagggactagatatagttgttgttgagaaagagcccgatgtaggctggggggcc
tctaaggctaatacatctataattcacccgggacacgaggaagaccccgagttacaccct
cttagagcgagactctgcgtggaaggtaacaagctctggcgtcaatgggttaaggagctg
gatataccggcaaagtggcctggtgaactaatggtcttcactaacagcgaggaagagaag
gaagcgctgagatacattgacacagccagaagaaacaatgtgccaggggttagggcggta
tatggagatgaattaaggagacttgaaccagctataagcccgatggctgtgggggcagta
tatgcacccacagctggtaatatatcaccttttgaagctgttgccgcgctagccgagaac
cttgttgaaaatggtgggagaatactcgtgaatacactggttaaatcagtcagaattaaa
gacaaagctgttgaaggagttgaaacaagtggagggtttattcaggccgacatagtgatt
aatgctgcgggtgttcatgccgacgagatttcccacagcgctggtgtcgaagaggacttc
gtgataaggcctaggaaaggggaatatatagtatttgatgaggataccagcgttaaaccc
ttaaggcttctgcatacaacacctacaagtttaaccaaaggagtttacgctatcacgaca
accgggggagacttactcataggtcctacggcagtggacatgccatacgagttgaaagag
gatacctcaacaacacttgaaggcatcgagtatttactcagggaagcaggtaaactactg
agagagctacctcctagatcacttatcacgaggacatttgctggtgtaagacctgagccc
ccacatggtgaatggctgattaaagtatacgaggagccatggggcttcatcaatgttgca
gggataagatccccagggctcacagcagcccctgcaatagcatattatgtagcagacatg
atctctaaatcatacgcggtgagcctggagcacaggagtgactggaagccttatagaaga
ggattcctcaggcttcacggtaaatccctacgggaaatagatgaactagtatcggtaaac
cctgattacggcgaggtaatatgctactgtagaaccgtatcaaaggcggagatacttgaa
gcggttaagaggattaagaccataggagcgcaggtaacccttgacggtgtaaagtttagg
actaaagctggattcggcaggtgccagggctccttctgcaggtggaggatagcggggatt
attgctggcttggagggtaaggagatgcatgaagttgtagtcaagatggagagatatggt
ttgggagatgttaaaaagatgctgagagaggaagcctag

DBGET integrated database retrieval system